KEGG   Immundisolibacter cernigliae: PG2T_00740Help
Entry
PG2T_00740        CDS       T04454                                 

Definition
(GenBank) aldolase
  KO
K14585  trans-o-hydroxybenzylidenepyruvate hydratase-aldolase [EC:4.1.2.45]
Organism
gbi  Immundisolibacter cernigliae
Pathway
gbi00626  Naphthalene degradation
gbi01100  Metabolic pathways
gbi01120  Microbial metabolism in diverse environments
gbi01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:gbi00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00626 Naphthalene degradation
    PG2T_00740
Enzymes [BR:gbi01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.45  trans-o-hydroxybenzylidenepyruvate hydratase-aldolase
     PG2T_00740
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHDPS
Motif
Other DBs
NCBI-ProteinID: ANX02865
UniProt: A0A1B1YQ33
Position
144408..145403
Genome map
AA seq 331 aa AA seqDB search
MPRRDRLTVNDVHGAWAIIPTPAVDNAEDWRCEDSIDYDEVAKAVDGLIVGGVDAIMAQG
TFGEGATITWEEKKKMMSVMVETARGRKPIFVGVTTLNTRDTIKQLKHARDIGADGTMLG
LPMWQVCDVPNAVRFYRDVAEAVPEMAICVYANPEAFKFQFPTPFWAGVAEIPQVITCKY
IHIGQLSIHTAVTKKRIRFLPIEFDHLDAARIDPEFHTAFWSPCANGGPEMTIRIRDTVK
EAVKTGDWSTALRVWGAAAPVMGHLMPPGGFPEFSRYNIQLDKARINASGWMKAGPCRPP
YLTAPANYLEGAVKAGKGWAELCAKVRAGEL
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atgccaagacgcgaccgcctgaccgtgaacgacgttcacggcgcctgggccatcatcccc
accccggccgtggacaacgccgaggactggcgctgcgaggacagcatcgactatgacgag
gttgccaaggccgtcgacggcctgatcgtgggcggcgtcgacgccatcatggcccagggc
accttcggcgaaggcgccaccatcacctgggaagaaaagaaaaagatgatgtcggtgatg
gtcgagaccgcccgcggccgcaagcccatcttcgtcggcgtgaccacgctgaacacccgc
gacaccatcaagcagctgaagcacgcgcgcgacatcggcgccgacggcaccatgctcggc
ctgcccatgtggcaggtgtgcgacgtgcccaacgcggtgcgcttctaccgcgacgtggcc
gaggcggtgccggaaatggcgatctgcgtgtacgccaacccggaggcgttcaagttccag
ttcccgaccccgttctgggccggcgtggcggaaattccgcaggtcataacctgtaagtac
atccacattggccagctgtccatacacacggcggtgaccaaaaagcgcatccgtttcctg
ccgatcgagttcgatcacctggacgccgcgcgcatcgatccggagttccacaccgccttc
tggtcgccctgcgccaacggtggaccggagatgaccatccgcatccgcgacaccgtaaag
gaagccgtcaagaccggcgactggagcaccgcgctgcgcgtatggggcgccgctgcgcca
gtcatgggccatctgatgccgccgggtggtttcccggagttctcgcgctacaacatccag
ctcgacaaggcgcgcatcaacgccagcggctggatgaaggccggcccctgccgtccgccg
tacctgaccgccccggccaactaccttgaaggcgccgtcaaggccggcaagggctgggcc
gagctgtgcgccaaggtgcgcgccggcgagctgtaa

DBGET integrated database retrieval system