KEGG   Immundisolibacter cernigliae: PG2T_01240
Entry
PG2T_01240        CDS       T04454                                 

Definition
(GenBank) hypothetical protein
  KO
K15755  2'-aminobiphenyl-2,3-diol 1,2-dioxygenase, large subunit [EC:1.13.11.-]
Organism
gbi  Immundisolibacter cernigliae
Pathway
gbi00621  Dioxin degradation
gbi01100  Metabolic pathways
gbi01120  Microbial metabolism in diverse environments
gbi01220  Degradation of aromatic compounds
Module
gbi_M00544  Carbazole degradation, carbazole => 2-oxopent-4-enoate + anthranilate
Brite
KEGG Orthology (KO) [BR:gbi00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00621 Dioxin degradation
    PG2T_01240
Enzymes [BR:gbi01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.-  
     PG2T_01240
SSDB
Motif
Pfam: LigB
Other DBs
NCBI-ProteinID: ANX02949
UniProt: A0A1B1YQA4
Position
complement(253858..254673)
AA seq 271 aa
MGSIVAAAATSHVVMDPANIPAQAGLVIDGFRRIAAEVARTQPDLLLYITSDHMVNLGYR
LQPSFALGCADSYTPLGDMDIPRQPMAGAGVFADALLRHLDEVGFDLARAESLDPDHGIA
LPMRIINPGGRVPVAPLLVNINRTPPPSPARCYALGQAIGAYIRSAACTQRVAVIGAGGL
SHWIATPGMGRVNADFDRQVLSLLGAGQAAQIATWSTDYILENAGNGGLEIMCWLAMAGT
VAGATGHTLYYEPIASWYTGMGAMAMDLAAA
NT seq 816 nt   +upstreamnt  +downstreamnt
atgggcagcatcgtcgccgccgccgccacctcgcacgtggtgatggaccccgccaacatc
ccggcccaggccggcctggtgatcgacggcttcaggcggatcgccgccgaagtcgcgcgc
acgcagccggacctgctgctgtacatcacctccgaccacatggtgaacctcggctaccgg
ctgcagccgagcttcgcactgggttgcgccgacagctacacgccgctgggcgacatggat
atcccgcgccagccgatggccggcgccggcgtcttcgccgacgccctgctgcgacacctg
gacgaggtcggcttcgacctggcccgggccgaatcgctggacccggatcacggcatcgcg
ctgccgatgcgcatcatcaaccccggcgggcgagtgccggtggcgccgctgctggtcaac
atcaaccgcacgccgccgccatcgccggcgcgctgctacgcactcggccaggcaatcggc
gcctacatccgcagcgccgcctgcacgcagcgcgtggccgtcatcggcgccggcggcctg
tcgcactggatcgccaccccgggcatgggccgcgtcaatgccgacttcgaccggcaggtg
ctgagcctgctcggcgcgggccaggcggcgcaaatcgccacctggagcaccgactacatc
ctcgagaacgccggcaatggcggcctcgaaatcatgtgctggctggccatggccggcacc
gtggccggtgccaccggccacaccctttattacgagccgatcgccagctggtacaccggc
atgggcgccatggcaatggatctggccgcggcctga

DBGET integrated database retrieval system