KEGG   Immundisolibacter cernigliae: PG2T_03105
Entry
PG2T_03105        CDS       T04454                                 

Definition
(GenBank) S-(hydroxymethyl)glutathione dehydrogenase/class III alcohol dehydrogenase
  KO
K00121  S-(hydroxymethyl)glutathione dehydrogenase / alcohol dehydrogenase [EC:1.1.1.284 1.1.1.1]
Organism
gbi  Immundisolibacter cernigliae
Pathway
gbi00010  Glycolysis / Gluconeogenesis
gbi00071  Fatty acid degradation
gbi00350  Tyrosine metabolism
gbi00620  Pyruvate metabolism
gbi00625  Chloroalkane and chloroalkene degradation
gbi00626  Naphthalene degradation
gbi00680  Methane metabolism
gbi01100  Metabolic pathways
gbi01110  Biosynthesis of secondary metabolites
gbi01120  Microbial metabolism in diverse environments
gbi01200  Carbon metabolism
gbi01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:gbi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PG2T_03105
   00620 Pyruvate metabolism
    PG2T_03105
  09102 Energy metabolism
   00680 Methane metabolism
    PG2T_03105
  09103 Lipid metabolism
   00071 Fatty acid degradation
    PG2T_03105
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    PG2T_03105
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    PG2T_03105
   00626 Naphthalene degradation
    PG2T_03105
Enzymes [BR:gbi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     PG2T_03105
    1.1.1.284  S-(hydroxymethyl)glutathione dehydrogenase
     PG2T_03105
SSDB
Motif
Pfam: ADH_zinc_N ADH_N Glu_dehyd_C ADH_zinc_N_2 AlaDh_PNT_C CLLAC
Other DBs
NCBI-ProteinID: ANX03278
UniProt: A0A1B1YR63
Position
654193..655302
AA seq 369 aa
MKARAAIAWAAGRPLEIDEVEVAGPKAGEVLVRMVATGVCHTDAYTLSGRDPEGVFPAIL
GHEGGGIVEDIGPGVTTLKPGDHVIPLYTPECGQCKFCTSGKTNLCQAIRATQGRGLMPD
GTSRFTARGKTVFHYMGTSTFSEYTVLPEIAVARINPAAPLDKVCLLGCGITTGIGAVLN
TAKVQPGSTVAVFGLGAIGLSAVQGAVMAGAARIIGIDLNPAKFELARQLGATDCVNPAE
HAAPVQEVIVEMTDGGVDYSFECIGNVEVMRAALECCHKGWGESTIIGVAGGGEEIRTRP
FQLVTGRVWRGSAFGGVKGRSQLPGYVDRYLAGQIHVDEFVTHTLPLEQINHAFELMHAG
QSIRSVILF
NT seq 1110 nt   +upstreamnt  +downstreamnt
atgaaagcacgcgccgccatcgcctgggccgccggccggccgctggaaatcgacgaggtc
gaagtggccggacccaaggccggcgaggtgctggtgcgcatggtggcgaccggtgtgtgc
cacaccgacgcctacaccctgtccggccgcgacccggagggcgtgttcccggccatcctg
gggcatgagggcggcggcatcgtcgaggacatcggccccggcgtcaccacgctcaagccc
ggcgatcatgtcattccgctctacacgcccgagtgcgggcagtgcaagttctgcacctcg
ggcaagaccaacctgtgccaggccatccgcgccacgcagggcaggggcctgatgccggac
ggcacgtcgcgcttcaccgcccgcggcaagaccgtcttccattacatgggcacctccact
ttcagcgaatacacggtgctgccagaaatcgccgtggccaggatcaaccccgccgcgcca
ctggacaaggtgtgcctgctcggctgcggcatcaccaccggcatcggcgcggtgctcaac
accgccaaggtgcagcccggatcgaccgtggcggtgttcggtctgggcgcgatcggtctt
agcgccgtgcagggcgcggtgatggccggcgctgcacgcatcatcggcatcgatctgaac
cccgccaagttcgagctggcgcggcagctgggcgccaccgactgcgtgaacccggccgag
cacgcggcgccggtccaggaggtgatcgtggagatgaccgacggcggcgtcgattattcc
ttcgagtgcatcggcaacgtggaggtgatgcgcgcggcgctggagtgctgccacaagggc
tggggcgagtcgaccatcatcggcgtggccggcggcggcgaggaaatccgcacccggccg
ttccagctggtcaccggccgggtgtggcgcggcagcgcattcggcggcgtcaaggggcgc
tcgcagctgcccggctacgtggaccgctatctggccgggcagattcacgtggacgagttc
gtcacccacaccctgccgctggagcagatcaaccacgccttcgagctgatgcatgccggc
cagagcatccgcagcgtgatcctgttctag

KEGG   Immundisolibacter cernigliae: PG2T_13790
Entry
PG2T_13790        CDS       T04454                                 

Definition
(GenBank) alcohol dehydrogenase
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
gbi  Immundisolibacter cernigliae
Pathway
gbi00010  Glycolysis / Gluconeogenesis
gbi00071  Fatty acid degradation
gbi00350  Tyrosine metabolism
gbi00620  Pyruvate metabolism
gbi00625  Chloroalkane and chloroalkene degradation
gbi00626  Naphthalene degradation
gbi01100  Metabolic pathways
gbi01110  Biosynthesis of secondary metabolites
gbi01120  Microbial metabolism in diverse environments
gbi01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:gbi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PG2T_13790
   00620 Pyruvate metabolism
    PG2T_13790
  09103 Lipid metabolism
   00071 Fatty acid degradation
    PG2T_13790
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    PG2T_13790
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    PG2T_13790
   00626 Naphthalene degradation
    PG2T_13790
Enzymes [BR:gbi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     PG2T_13790
SSDB
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 HP_OMP
Other DBs
NCBI-ProteinID: ANX05146
UniProt: A0A1B1YWQ6
Position
complement(2918940..2919965)
AA seq 341 aa
MQAMLLSRLGEVADDGAVLEARELPMPEPAAGEALIEVSCCGVCHTELDEIEGRTPPHLP
IVPGHQVVGRVISAPAGSQLRAGQRVGVAWIFSACGHCEHCREGRENLCAQFVATGRDAH
GGYAQFMTAPADFVHPLPDALGDLEAAPLLCAGAVGYRALSLCRLEDGQALGLTGFGASG
HLVLQMARARFARSPIHVFTHNAAQRALALELGATWAGAADAQSPTLLHAIIDTTPAWAP
LRAALRNLRPGGRLVVNAIRKESTDAAVMAGIDYAGELWLEKSVQSVANVTRADVRECLA
LAAQADIRPRLRVYALADANRALADIKFGRHAGAKVLQVAG
NT seq 1026 nt   +upstreamnt  +downstreamnt
atgcaggccatgctgctgagtcggctcggcgaagtggccgacgacggcgcggtcctggag
gcgcgcgaactgccgatgcccgagccggccgcaggcgaggcgctgatcgaggtgtcctgt
tgcggcgtgtgccacacggaactggacgaaatcgaaggccgcacaccgccgcacttgccc
atagtgccgggccatcaggtggtcgggcgggtgatcagcgcgcccgctggtagtcagctg
cgggccggccagcgggtcggcgtggcgtggattttcagcgcctgcggccactgcgagcac
tgccgcgaagggcgcgagaacctgtgcgcgcagttcgtcgccaccgggcgcgacgcccac
ggcggctatgcgcagttcatgaccgcgccggccgatttcgtgcatccgctgccggatgcg
ctcggcgatctggaggccgccccgctgctgtgcgccggggcggtcggctatcgcgccctg
tcgttgtgccggctcgaagacggccaggcgctgggcctgaccggcttcggtgccagcgga
catctggtgctgcagatggcgcgggcgcgctttgcgcgctcgccgatccacgtattcacc
cacaatgcggcgcaacgggcgctggcgctggagcttggtgccacctgggccggtgcggcc
gatgcgcaatcgccaacgttgctgcacgccatcatcgacaccacgccggcctgggcgccg
ctgcgggcggcgctgcgcaacctgcgcccgggcgggcggctggtcgtgaatgccattcgc
aaggaaagcaccgacgccgcggtcatggccggcatcgactacgccggcgagctgtggctg
gaaaaatccgtgcagtcggtggccaacgtcacccgcgccgacgtgcgcgagtgcctggca
ctggccgcgcaggccgacatccggcccaggctgcgggtctatgcgctggcagacgccaac
cgggcgcttgccgacatcaagttcggccgccatgccggggccaaggtgctgcaggtggcc
gggtag

DBGET integrated database retrieval system