KEGG   Immundisolibacter cernigliae: PG2T_03615
Entry
PG2T_03615        CDS       T04454                                 

Definition
(GenBank) hypothetical protein
  KO
K18243  salicylate 5-hydroxylase small subunit [EC:1.14.13.172]
Organism
gbi  Immundisolibacter cernigliae
Pathway
gbi00626  Naphthalene degradation
gbi01100  Metabolic pathways
gbi01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:gbi00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00626 Naphthalene degradation
    PG2T_03615
Enzymes [BR:gbi01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.172  salicylate 5-hydroxylase
     PG2T_03615
SSDB
Motif
Pfam: Ring_hydroxyl_B SnoaL_4
Other DBs
NCBI-ProteinID: ANX03366
UniProt: A0A1B1YRF8
Position
complement(769777..770256)
AA seq 159 aa
MVSYLEHCRAIDELLGLYALVVDGQEWERWPALFAEDCYYAVVSIENVEQDLPLAYMLDD
SRERILDRVKFVREVWAGTVEPYRTRHSIQRTMTMDLGSGVYEVQANFLVGYTLGDGTAG
MLAMGHYEDQIAVGEEGALFLRKVVYLDNVPPRYLIYPL
NT seq 480 nt   +upstreamnt  +downstreamnt
atggttagttatcttgagcattgtcgcgccatcgacgagttgctgggcttgtatgcgctc
gttgtggacggacaggaatgggaacgttggcctgcactgtttgcggaagattgctattat
gcggtggtcagcatcgagaatgtcgagcaggatttgccgctagcctacatgttggacgac
tcgagggaacggattcttgaccgagtcaagtttgtgcgtgaggtatgggcggggaccgtc
gagccatatcgcacgcggcacagcattcagcgcaccatgaccatggacctgggcagtggt
gtctacgaggttcaggcaaattttctcgtcggctatacgttgggcgacggaacggctggt
atgctggcaatgggtcattacgaagatcagatagcggtcggagaagaaggtgcgctattt
ttgcgaaaggtggtgtatttggataatgtgccgcctcgttacctgatatatccgttgtga

DBGET integrated database retrieval system