KEGG   Immundisolibacter cernigliae: PG2T_05760
Entry
PG2T_05760        CDS       T04454                                 

Definition
(GenBank) hypothetical protein
  KO
K14585  trans-o-hydroxybenzylidenepyruvate hydratase-aldolase [EC:4.1.2.45]
Organism
gbi  Immundisolibacter cernigliae
Pathway
gbi00626  Naphthalene degradation
gbi01100  Metabolic pathways
gbi01120  Microbial metabolism in diverse environments
gbi01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:gbi00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00626 Naphthalene degradation
    PG2T_05760
Enzymes [BR:gbi01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.45  trans-o-hydroxybenzylidenepyruvate hydratase-aldolase
     PG2T_05760
SSDB
Motif
Pfam: DHDPS
Other DBs
NCBI-ProteinID: ANX03747
UniProt: A0A1B1YSS8
Position
1206160..1207119
AA seq 319 aa
MLSVNDIKGLYAITPTPSKPGAERWDATDTVDLDELARLTEALVQSGVNGMVAMGTTGEC
ATLTNSEWEQAAACVIETVRKRVPLFVGTTALGTHEIVRRNRFILDLGADGTMLGLPMWQ
PCTLDMAVQFYADMSEAFPQLAIMAYDNPGAFRFNFPPPFWAQVARRAPTVICTKHGPDP
MISALIGMTQGKIRFLPHIAGAYAMARIEPEHNIAFWATEASMGPEPALALRDAIDAGDW
ARAKAIDTDIGYTMQTFFPPGGMAEFASYNIQLEKIRFDESGYCKAGPIRPPYHVIPDTI
EQGARECGRRWKALRGKYG
NT seq 960 nt   +upstreamnt  +downstreamnt
atgctcagcgtgaacgacatcaagggcctgtacgccatcaccccgacaccgtccaaaccc
ggcgccgagcgctgggacgccaccgacacggtggacctggacgaactggcgcgcctgacc
gaggcgctggtgcaaagcggcgtcaacggcatggtggccatgggcaccaccggcgagtgc
gccacgctgaccaacagcgagtgggaacaggccgccgcctgcgtgatcgaaacggtccgc
aagcgcgtgccgctgttcgtgggcaccactgcattgggcacgcacgagatcgtgcgccgc
aaccgcttcatcctggacctgggcgccgacggcaccatgctgggcctgcccatgtggcag
ccgtgcacgctggacatggcggtgcagttctacgccgacatgtccgaggcgttcccgcag
ctggccatcatggcctacgacaatccgggcgcgtttcgcttcaacttcccgccgccgttc
tgggcgcaggtggcgcgccgcgcgccgaccgtgatctgcaccaagcacggcccggacccg
atgatcagcgcgctgatcggcatgacgcagggcaagatccgcttcctgccgcacattgcg
ggcgcctatgccatggcgcgcatcgagccggaacacaacatcgccttctgggccaccgag
gccagcatggggccggagccggcgctggcgctgcgcgacgccatcgatgccggtgactgg
gcccgcgccaaggccatcgacaccgacatcggctacaccatgcagaccttcttcccgccg
ggcggcatggccgagttcgcgtcctacaacatccagctggaaaaaatccgcttcgacgag
tccggctactgcaaggccgggccgatccgcccgccgtatcacgtgatcccggacaccatc
gagcagggtgcgcgcgagtgcggccggcgctggaaggcgctgcgcggcaagtacggctga

DBGET integrated database retrieval system