KEGG   Immundisolibacter cernigliae: PG2T_09915Help
Entry
PG2T_09915        CDS       T04454                                 

Definition
(GenBank) 3,4-dihydroxy-2-butanone-4-phosphate synthase
  KO
K14652  3,4-dihydroxy 2-butanone 4-phosphate synthase / GTP cyclohydrolase II [EC:4.1.99.12 3.5.4.25]
Organism
gbi  Immundisolibacter cernigliae
Pathway
gbi00740  Riboflavin metabolism
gbi00790  Folate biosynthesis
gbi01100  Metabolic pathways
gbi01110  Biosynthesis of secondary metabolites
Module
gbi_M00125  Riboflavin biosynthesis, GTP => riboflavin/FMN/FAD
Brite
KEGG Orthology (KO) [BR:gbi00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    PG2T_09915
   00790 Folate biosynthesis
    PG2T_09915
Enzymes [BR:gbi01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.25  GTP cyclohydrolase II
     PG2T_09915
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.99  Other carbon-carbon lyases
    4.1.99.12  3,4-dihydroxy-2-butanone-4-phosphate synthase
     PG2T_09915
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHBP_synthase GTP_cyclohydro2
Motif
Other DBs
NCBI-ProteinID: ANX05584
UniProt: A0A1B1YXH7
Position
2092736..2093860
Genome map
AA seq 374 aa AA seqDB search
MHLNSTEEIIADIKAGKMVILMDDADRENEGDLILAGECVTPEAINFMARYGRGLICLTL
TEARCRQLNLPLMVADNNDKNTTNFTVSIEAASGVTTGISAADRAVTVQAAVKPDARPGD
IVMPGHIFPLRAQPGGVLTRAGHTEAGCDLARLAGLEPSAVIVEILNEDGSMARYPQLVE
FAQTHNLKIGTIADLIRYRVEQEGSVEWVAESSFESEFGSFRLVAFHENDHGEVHLALVM
GDIRRDEPTLARVQQASVLRDILGAQSPNRWSVRRALSTIADAGRGVLVLLSPTDLPQTL
LGEVQAYKMRHLGVPLPGLDPNPELRMYGVGAQILAQLGVGRMRIMGKPRKLHGLAGFGL
ELVDFVPPEAAREE
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
atgcacctgaacagcaccgaagaaatcatcgccgacatcaaggccggcaagatggtcatc
ctgatggatgacgccgaccgcgagaacgagggcgacctgatcctggccggcgagtgcgtg
acaccggaggccatcaacttcatggcccgctacggccgcggcctgatctgcctgaccctg
accgaggcacgctgccggcagctgaacctgccgctgatggtggccgacaacaacgacaag
aacaccaccaatttcacggtgtcgatcgaggccgccagcggcgtcaccaccggcatttcg
gccgccgaccgggcggtgaccgtgcaggcggccgtcaagcccgacgcgcggccgggcgac
atcgtcatgccgggccacatctttccgctgcgcgcgcagccgggcggcgtgctgacgcgc
gccggccacaccgaggccggctgcgacctggcgcgcctggccggcctggagccctcggcc
gtgatcgtcgagatcctgaacgaagacggcagcatggcccgctacccgcagctggtcgaa
ttcgcccaaacgcacaacctcaagatcggcaccatcgccgacctgatccgctaccgggtg
gagcaggaaggctcggtcgagtgggtggccgagagcagcttcgagagcgaattcggcagc
ttccggctggtggccttccacgaaaacgaccacggcgaggtgcacctggcgctggtgatg
ggcgacatccgccgcgacgagccgaccctggcgcgggtgcagcaggccagcgtgctgcgc
gacatcctgggcgcccagtcgccgaaccgctggtccgtacgccgggcactctcgaccatt
gccgacgcgggtcgcggggttctggtgctgctcagtccgaccgacctgccgcagaccctg
ctgggcgaggtgcaggcctacaagatgcgtcacctgggcgtgccgctgccgggcctggac
ccgaacccggagctgcgcatgtacggcgttggtgcgcagatcctggcgcagctgggagtc
gggcgcatgcgcatcatgggcaagccgcgtaaactgcacggtcttgccggttttggcctg
gaactggtcgatttcgtgccgcccgaggcggcccgcgaggaatga

DBGET integrated database retrieval system