KEGG   Immundisolibacter cernigliae: PG2T_10480Help
Entry
PG2T_10480        CDS       T04454                                 

Definition
(GenBank) asparaginyl/glutamyl-tRNA amidotransferase subunit C
  KO
K02435  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit C [EC:6.3.5.6 6.3.5.7]
Organism
gbi  Immundisolibacter cernigliae
Pathway
gbi00970  Aminoacyl-tRNA biosynthesis
gbi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gbi00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    PG2T_10480
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:gbi03029]
    PG2T_10480
Enzymes [BR:gbi01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     PG2T_10480
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     PG2T_10480
Mitochondrial biogenesis [BR:gbi03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    PG2T_10480
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glu-tRNAGln
Motif
Other DBs
NCBI-ProteinID: ANX04556
UniProt: A0A1B1YUZ7
Position
2198049..2198336
Genome map
AA seq 95 aa AA seqDB search
MSISSDEVRKVAHLARIEVSADQLTTYAAELSTILELVTQLDGADTAQVPPLAHPIDASQ
RLRADTVAETDQRRRFQAIAPAVQDGLYLVPKVIE
NT seq 288 nt NT seq  +upstreamnt  +downstreamnt
gtgtcgataagcagcgacgaggtgcgcaaggtggcgcacctggcccgcatcgaggtgtcg
gccgatcagctgacgacctatgcggccgaactgagcaccattctggaactggtgacccag
ctggacggtgccgacaccgcgcaggtgccccccctggcccatccgatcgacgccagccag
cgcctgcgcgccgataccgtcgccgaaaccgaccagcggcgccgcttccaggccatcgca
ccggcggtgcaggacggcctgtatctggtgccaaaggtcatcgaatga

DBGET integrated database retrieval system