KEGG   Immundisolibacter cernigliae: PG2T_11980Help
Entry
PG2T_11980        CDS       T04454                                 

Definition
(GenBank) dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
gbi  Immundisolibacter cernigliae
Pathway
gbi00010  Glycolysis / Gluconeogenesis
gbi00020  Citrate cycle (TCA cycle)
gbi00620  Pyruvate metabolism
gbi01100  Metabolic pathways
gbi01110  Biosynthesis of secondary metabolites
gbi01120  Microbial metabolism in diverse environments
gbi01130  Biosynthesis of antibiotics
gbi01200  Carbon metabolism
Module
gbi_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:gbi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PG2T_11980
   00020 Citrate cycle (TCA cycle)
    PG2T_11980
   00620 Pyruvate metabolism
    PG2T_11980
Enzymes [BR:gbi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     PG2T_11980
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl Biotin_lipoyl_2 E3_binding GCV_H HlyD_3 RnfC_N PASTA NQRA INO80_Ies4 DUF2254
Motif
Other DBs
NCBI-ProteinID: ANX04813
UniProt: A0A1B1YVZ4
Position
complement(2491760..2493391)
Genome map
AA seq 543 aa AA seqDB search
MEQNLIVPGLAENVHEADVAEVSVKVGDTIAEGDIILTLETDKAAMELPAEFGGKVVAVK
VKAGQKVKEGDVIVVLETTVGAEPPPEESAASGPAASTSAPEAKPAAAAASEAEPASPAA
STPTLQPVTCPDLGDGKAADVIELAVKPGDTVAEGDALLTVETEKAATELPAPFAGTVRE
LKVKVGDKLKTGDLVAMIETAAAQAPAAAPEPVPEAASPPAAAPAPLAVAPAPQLTATPP
PSGQLPHATPSVRRFARELGVDLAQVAGSGRKGRITQEDVQAFVKSVLQGGATGTATGAG
LAPLPVIDFAQWGEVETVALGRIRQLTGENLGRSWPQLPQVTQHDEADITDLEAFRKARG
KDAEARGTKLTVVALLLKACAGALKAFPDFNASLAVDGKSLIVKRYIHIGVAVDTPNGLV
VPVIRDVDRKGIIDLAAELADLSARARERKLKSDEMRGGSFTISSLGGIGGTAFTPIVNW
PEVAILGVSRASLKPVWDGAAFAPRLMLPLSLSYDHRVIDGAAGARFTRHLAGLLEDLRG
LLL
NT seq 1632 nt NT seq  +upstreamnt  +downstreamnt
atggaacagaacctcatcgtgccgggactggccgagaacgtgcacgaagccgacgtggcc
gaggtgtcggtcaaagtcggcgataccatcgccgagggcgacatcatcctgacgctggaa
accgacaaggccgccatggagctgccggccgagttcggcggcaaggtcgtggcggtgaag
gtcaaggccgggcagaaggtcaaggaaggcgatgtcatcgtggtgctggaaaccacggtc
ggcgccgagccgccgcccgaggaaagcgccgcatccggcccggcagcgtcgacatcggcg
cccgaagctaagccagcagccgctgcagcgtctgaggccgaacccgcttctccagcggcc
agcactcccaccctgcagccggtcacctgccccgatcttggcgacggcaaggccgccgac
gtgatcgagctggccgtgaaacccggcgacacggtggccgagggcgacgccctgctcacg
gtcgagaccgagaaagccgccaccgagctgccggcgccgttcgccggcacggtgcgcgag
ctgaaggtcaaggtcggcgacaaactgaaaaccggcgacctggtggccatgatcgaaacg
gcggcggcgcaggcacccgccgcggcaccggaacccgtaccggaggcggcatcaccgccg
gccgctgcacctgcgcccctggcagtcgccccggcgccgcagctgaccgccactcccccg
ccgtctggccagctcccccacgccacaccgtcggtccggcgttttgcgcgcgagctgggt
gtcgatctggcccaggtcgccggcagcgggcgcaagggccgcatcacgcaggaagacgtg
caggccttcgtcaagtccgtgctgcagggcggggcgacgggaaccgcgaccggcgccggc
ctggcgccgctgccggtgatcgattttgcccagtggggcgaggtcgaaaccgtggcgctc
ggccgcatccgccagctgaccggcgagaacctcggccgctcctggccgcagctgccgcag
gtcacgcagcacgacgaggccgacatcacggacctggaagccttccgcaaggcgcgcggc
aaggacgccgaggcccgcggcaccaagctgaccgtggtcgcgctgctgctgaaggcctgc
gcgggggcgctaaaagccttcccggacttcaacgccagcctggcggtggacggcaagtcg
ctgatcgtcaagcgctacatccacatcggcgtggccgtggacacgcccaatgggctggtg
gtgccggtgattcgcgacgtggaccgcaagggcatcatcgacctggcggcggaactcgcg
gacctgagcgcccgcgcccgcgagcgcaagctcaaatccgacgaaatgcgcggcggcagc
ttcaccatctccagcctgggcgggattggcggcaccgccttcacgccgatcgtcaactgg
ccggaagtggccatcctgggcgtgtcgcgcgcatcgctgaaaccggtgtgggacggcgcc
gccttcgccccgcgcctgatgctgccgctgtcgctgtcctacgaccaccgcgtcatcgac
ggcgccgccggggcacgcttcacccgccacctggccggcctgctggaagacctgcgcggc
cttctgctctga

DBGET integrated database retrieval system