KEGG   Immundisolibacter cernigliae: PG2T_13720Help
Entry
PG2T_13720        CDS       T04454                                 

Definition
(GenBank) beta-ketoadipyl CoA thiolase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
gbi  Immundisolibacter cernigliae
Pathway
gbi00071  Fatty acid degradation
gbi00072  Synthesis and degradation of ketone bodies
gbi00280  Valine, leucine and isoleucine degradation
gbi00310  Lysine degradation
gbi00362  Benzoate degradation
gbi00380  Tryptophan metabolism
gbi00620  Pyruvate metabolism
gbi00630  Glyoxylate and dicarboxylate metabolism
gbi00640  Propanoate metabolism
gbi00650  Butanoate metabolism
gbi00900  Terpenoid backbone biosynthesis
gbi01100  Metabolic pathways
gbi01110  Biosynthesis of secondary metabolites
gbi01120  Microbial metabolism in diverse environments
gbi01130  Biosynthesis of antibiotics
gbi01200  Carbon metabolism
gbi01212  Fatty acid metabolism
gbi02020  Two-component system
Brite
KEGG Orthology (KO) [BR:gbi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    PG2T_13720
   00630 Glyoxylate and dicarboxylate metabolism
    PG2T_13720
   00640 Propanoate metabolism
    PG2T_13720
   00650 Butanoate metabolism
    PG2T_13720
  09103 Lipid metabolism
   00071 Fatty acid degradation
    PG2T_13720
   00072 Synthesis and degradation of ketone bodies
    PG2T_13720
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    PG2T_13720
   00310 Lysine degradation
    PG2T_13720
   00380 Tryptophan metabolism
    PG2T_13720
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    PG2T_13720
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    PG2T_13720
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    PG2T_13720
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:gbi04147]
    PG2T_13720
Enzymes [BR:gbi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     PG2T_13720
Exosome [BR:gbi04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   PG2T_13720
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: ANX05133
UniProt: A0A1B1YWZ1
Position
2903491..2904693
Genome map
AA seq 400 aa AA seqDB search
MLDAYIYGGLRSPFGRHGGALAPLRPDNLAAQVTRAVLAGFALGEAAVEDLLLGCTCQAG
EDARNVARHVALLSGLGEAVPGQTVNRLCASGLAAVLDAARAISCGEGGLYLAGGVESMS
RAPFVVGKAEQAFSRDFKVFDSAIGARFPNPLIGAQFGEDTMSQTADNVAREYAIGREDS
DAYAARSQARYARALADGFFAGEITPVEVPSGSKAPPIRVAEDEHPRPQSTAESLAKLRP
LEAGGVTTAGNASGINDGAATLLVGSRALGERLGIAPLARILAGAVVGVAPRLMGIGPAL
AIPKAAARAGVRLADLDVIEINEAFAAQVLGCLKLLDLPFDDARVNPNGGAIAIGHPLGA
SGARLALTAARQLVAGGGRYAAVSLCIGVGQGLAVILERA
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgctcgacgcttatatctacggcggtctgcgctcgccctttggccgccacggcggggcg
ctggcgccgctgcggccggacaatctggcggcgcaggtcacgcgggcggtgctggccggc
tttgcgctgggggaggcggcggtcgaggacctgctgctgggctgtacctgccaggccggc
gaggatgctcgcaacgtcgcccgccacgttgccctgctgtccgggctgggtgaagccgtg
ccggggcagacggtcaatcgcctgtgcgcgtccgggctggcggcggtactggacgcggct
cgcgccatcagctgcggcgagggcgggctttatctggccggtggtgtggagagcatgagc
cgggcgccgttcgtagtcggcaaggccgagcaggccttcagccgcgatttcaaggtgttc
gattcagccatcggcgcgcgctttccgaacccgctgatcggcgcccagttcggcgaggac
acgatgtcgcagacggccgacaacgtggcgcgcgagtacgccatcggccgcgaagacagc
gatgcctatgccgcgcgctcgcaggcccgttacgcgcgggcgctggcggacggctttttt
gccggggagatcaccccggtggaagtgcccagcggcagcaaggcgccgccgatccgggtg
gccgaagacgagcatccgcgcccgcaaagcaccgccgagtcgctggccaaactgcggccg
ctcgaggccggtggcgtgaccaccgccggcaatgcctcgggcatcaacgacggcgccgcg
acgctgctggtcggcagccgggcgctgggcgagcggctgggcatcgcgccgctggcgcgc
atcctggcgggcgctgtggtgggcgtggcgccgcgcctgatgggcatcggcccggcgctg
gccatccccaaggcggcggcgagggccggcgtgcggctggcagacctcgatgtcatcgag
atcaacgaggccttcgcggcgcaggtgttggggtgcctgaagctgctcgacctgcccttc
gacgacgcgcgcgtgaatcccaacggcggcgccatcgccatcggccatccgctgggcgcc
tccggtgcgcggctggcgctgaccgcggcgcgccagctggtcgccggcggtggtcgctat
gcggcagtgagcctgtgcatcggtgtggggcagggcctggccgtgatcctggagcgcgcc
tga

DBGET integrated database retrieval system