KEGG   Immundisolibacter cernigliae: PG2T_14220Help
Entry
PG2T_14220        CDS       T04454                                 

Definition
(GenBank) cobyric acid synthase CobQ
  KO
K02232  adenosylcobyric acid synthase [EC:6.3.5.10]
Organism
gbi  Immundisolibacter cernigliae
Pathway
gbi00860  Porphyrin and chlorophyll metabolism
gbi01100  Metabolic pathways
Module
gbi_M00122  Cobalamin biosynthesis, cobinamide => cobalamin
Brite
KEGG Orthology (KO) [BR:gbi00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    PG2T_14220
Enzymes [BR:gbi01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.10  adenosylcobyric acid synthase (glutamine-hydrolysing)
     PG2T_14220
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GATase_3 CbiA AAA_26 MobB
Motif
Other DBs
NCBI-ProteinID: ANX05223
UniProt: A0A1B1YX76
Position
complement(3017931..3019406)
Genome map
AA seq 491 aa AA seqDB search
MSAPTLMVQGTTSDAGKTTLVAGLCRALQRRGWAVAPFKPQNMALNSAVTADGGEIGRAQ
ALQAQAAGLAPHTDMNPVLLKPNDDTGAQVIVHGRAIGNLDAASYHAFKPRLREAVLASH
RRLAGQYQAIIAEGAGSPAEINLRDGDIANMGFAEAVDCPVILIADIDRGGVFAHLVGTL
ALLSASERARVRGFVINRFRGDLTLLQSGLDWLERQTGIPVLGVLPYLHGLALDAEDAVA
SGQTAFVNGALQVLVPLLPRISNHTDFDPLRAHPQVSLRYLRGGDAWPAADLVILPGSKN
VRADLAFLRAQGWDQAIGRHLRYGGRLLGICCGLQMLGREIADPHGVEGAPGSSAGLGLL
DLVTTLAPNKRLANVSGRLLPDDVPVCGYEIHAGISHGPALNTPLVRLDDGRRDGARSAD
GQILATYLHGLFESAASLRALLAWAGLARPQPLDPAALREAAIERLADACVAHLDLDRIE
QLLRSGAPDTA
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
atgagcgccccgaccctgatggtgcagggcaccacctccgacgccggcaagaccacgctg
gtggccggcctgtgccgggccctgcagcggcgcggctgggcggtggcgccgttcaagccg
cagaacatggcgctcaacagcgccgtgacggcggacggcggcgaaatcggccgcgcccag
gccctgcaggcgcaggccgccggccttgccccgcacaccgacatgaacccggtgctgctg
aaaccaaacgacgacaccggcgcgcaggtgatcgtgcacggccgggcgatcggcaacctc
gatgccgccagctaccatgccttcaagccgcgcctgcgcgaggcggtactggcctcgcac
cgacgccttgccgggcagtaccaggcgatcatcgccgagggcgcgggctcgccggcggag
atcaacctgcgcgacggcgacatcgccaacatgggcttcgccgaggccgtcgactgcccg
gtgatcctgatcgccgacatcgaccgcggcggtgtgttcgcccatctggtcggcacactg
gcgctgctgtcggccagcgagcgggcgcgcgtacgcggctttgtcatcaaccgctttcgc
ggcgatctgacattgctgcaaagcggcctggactggctggaacgccagaccggcatcccg
gtgctgggcgtgttgccttacctgcacgggctggcactggacgccgaggacgccgtcgcc
agcggccagacggctttcgtcaacggtgcgcttcaggtgctggtgccgctgctgccgcgc
atcagcaaccataccgatttcgacccgctgcgtgcccatccgcaggtgtcgctgcgctat
ctgcgcggcggcgacgcctggccggcggccgacctggtcatcctgcccggctccaagaac
gtgcgtgccgacctggccttcctgcgcgcgcagggctgggaccaggccatcggccgccac
ctgcgctacggcggcaggctgctgggcatttgctgcgggctgcaaatgctgggacgggaa
atcgccgacccgcacggcgtggaaggcgcccccggcagcagcgccggactcggcctgctg
gacctggtcaccacgctggcgccaaacaagcgcctggccaatgtcagcggccgcctactg
cccgatgatgtgccggtgtgcggctacgaaatccacgccggcatcagccacggcccggca
ctgaacacgccgctggtgcggctggacgatggccggcgcgacggcgcccgcagcgcggat
ggacagatactggcgacttatctgcacggcctgtttgaatccgccgcgagcctccgggcg
ctgctggcctgggccggcttggcacggccccagccgctcgacccggcggcgctgcgcgaa
gcggccatcgagcgcctcgccgatgcctgcgtggcgcatctcgatctggaccgcatcgag
cagctgctgcgctccggtgcgcccgacacggcctga

DBGET integrated database retrieval system