KEGG   Citrifermentans bemidjiense: Gbem_2499
Entry
Gbem_2499         CDS       T00749                                 

Name
(GenBank) glycerol/1,2-propanediol dehydratase
  KO
K23121  trans-4-hydroxy-L-proline dehydratase [EC:4.2.1.172]
Organism
gbm  Citrifermentans bemidjiense
Pathway
gbm00330  Arginine and proline metabolism
gbm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gbm00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    Gbem_2499
Enzymes [BR:gbm01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.172  trans-4-hydroxy-L-proline dehydratase
     Gbem_2499
SSDB
Motif
Pfam: PFL-like Gly_radical
Other DBs
NCBI-ProteinID: ACH39507
UniProt: B5EGM4
Position
complement(2897430..2899790)
AA seq 786 aa
MTGRTERLRQESLDAEAAISAERALLLTEFYRENEGRWSIPVLRAKSFYYLCEKKTIYLG
DGELVVGERGPAPKLVPTYPELTCHSLKDLRILNSREKTSYRVDDACLKAYGETVIPYWS
TRSLRDKIFRELPEEWHEAYQSGIFTEFMEQRAPGHTVLDDKIYNKGLLDFKKEIADAIA
ALDFVSDPNAWSKREELKAMDISCDAVILFAERHAKLAESMAAACADAVRKQELLKIAAN
CRWVPAHAPTDFFEALQSYWFCHLAVITELNGWDAFSPGHLDQHLYPFYRDGLAAGTLKK
EEARELLECFFVKFNNHPSPPKVGVTAAESGTYTDFANINLGGLLPDGSDGSNEVSHLLL
DIIDEMHLLQPSSNIQLSRKSPDRFLKHTLRVVRKGYGFPSIFNADSVVEEQLRQGKTLA
DARAGGCSGCVEVGAFGKEAYILTGYFNLVKMLELALHDGVDPATGAQLGPATGKTESFA
CFDDVFAAFTRQLAHFIDIKIRGNRLIEMIYAGLMPAPFLSVLTDDCISRGVDYNAGGAR
YNNSFIQGVGIGSITDSLSAIKEHVFQEKAVSLPDLVAKLDADFASDEPLRQRLWNRTRK
YGNDDDFADDLMRQVFEAFFQQVDGRPNTKGGVYRIEMLPTTCHVYFGSVTGAMPDGRRR
GAPLSEGISPVQGADRQGPTAVIRSAGKMDHIRSGGTLLNLKFSPTLLAGEGGVDGLAAL
VRSYFRMDGHHVQFNVVDVETLKRAQADPRQYRDLIVRVAGYSDYFCDLSEELQNEIIAR
TEHTSL
NT seq 2361 nt   +upstreamnt  +downstreamnt
atgaccggaagaactgaacgtctgcggcaggagagccttgacgccgaggcggcgatttcg
gcggagcgcgcgctgctcctcaccgagttttaccgcgagaacgaggggcgctggtccatc
ccggtgctgcgggccaagtccttttactacctctgcgagaagaagaccatctatctcggc
gacggggaactggtggtgggggagagggggcctgctcccaagctggttccgacctacccg
gagcttacctgccactcgcttaaggacctgcgcatcctgaactcgcgcgagaagaccagc
taccgcgtcgacgacgcctgcctcaaggcttacggggagacggtgatcccctactggagc
acgaggtcgcttcgggacaagatcttccgggaactccccgaggaatggcacgaggcctac
caaagcggcatcttcaccgagttcatggagcagcgcgcccccgggcacacggtgttggac
gacaagatctacaataaggggctcctcgatttcaagaaggagatagcggacgccatcgcc
gcgctcgatttcgtcagcgatccgaacgcctggtccaagcgggaggagctgaaggcgatg
gatatctcctgcgacgccgtcatccttttcgccgaacgccacgcgaaacttgccgaaagc
atggccgcggcgtgcgccgatgccgtccgcaagcaggagctcttgaagatcgccgccaac
tgccgttgggttccggcgcacgcccctaccgatttcttcgaggcgctgcagtcctactgg
ttctgccacctggcggtcattacggagctgaacggctgggacgccttcagccccgggcac
ctcgaccagcacctctaccctttctaccgggacgggctcgccgccggcaccctgaaaaag
gaggaggcgcgcgagctcctcgaatgcttcttcgtcaagttcaacaaccacccctcgccc
cccaaggtgggggtgaccgcggccgagagcggcacctacaccgacttcgccaacatcaac
ctgggggggcttctcccggacggctccgacggctccaacgaggtgtcgcatctgcttctg
gacatcatcgacgagatgcacctgttgcagccttccagcaacatccagctctcccgcaag
tcccccgaccgcttcctgaagcacaccttgagggtggtgcgcaaggggtacggctttcca
tccatcttcaacgcggactccgtggtcgaggagcagctgcgccagggaaagacgctcgcg
gacgcccgcgcaggggggtgcagcggctgcgtcgaggtcggggcgttcggcaaggaggcc
tacatcctcaccggctacttcaacctggtgaagatgctggaactggcgctgcacgacggc
gtcgacccggcaaccggcgcccagctggggcccgctaccggtaaaacggagagtttcgcc
tgcttcgacgacgtcttcgccgccttcaccaggcagctcgcccatttcatcgatatcaag
atccgcggcaaccgcctcatcgagatgatctacgcaggcctcatgcccgctccgtttctg
tcggttttgaccgatgactgcatcagccgcggggtggattacaacgcgggaggtgccagg
tacaacaacagcttcatccagggggtggggatagggagcatcaccgattcgctctccgcc
atcaaggagcacgttttccaagagaaggcggtctcgctccccgacctggtggccaagctc
gatgcggacttcgcttcggacgagccgctcaggcagcggctttggaaccggacccgcaag
tacggcaatgacgacgacttcgccgacgacctgatgcggcaggtcttcgaggccttcttc
cagcaggtggacggcaggcccaacacgaaggggggcgtgtaccgcatcgagatgctcccg
accacctgccacgtctatttcggctcggtcaccggggcaatgcccgacggcaggcgccgg
ggcgctcccctttccgaggggatctcgccggtgcagggggcggaccgccagggacctacc
gccgtcatccgttcggccgggaagatggatcacatccgcagcggcggcacccttttgaac
ctgaagttctccccgacgcttttagccggggaggggggcgtcgacggactggcggcgctg
gtgcgcagctacttcaggatggacggccatcacgtccagttcaacgtggtggacgtggag
acgctgaaaagggcgcaggccgatccccggcagtaccgtgacctgattgtcagggtggcc
ggctacagcgattacttctgcgacctctccgaggagctgcaaaacgagatcatagccagg
accgagcacacgtccctgtga

DBGET integrated database retrieval system