KEGG   Geobacter bemidjiensis: Gbem_0001Help
Entry
Gbem_0001         CDS       T00749                                 

Gene name
dnaA
Definition
(GenBank) chromosomal replication initiator protein DnaA
  KO
K02313  chromosomal replication initiator protein
Organism
gbm  Geobacter bemidjiensis
Pathway
gbm02020  Two-component system
Brite
KEGG Orthology (KO) [BR:gbm00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Gbem_0001 (dnaA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:gbm03032]
    Gbem_0001 (dnaA)
   03036 Chromosome and associated proteins [BR:gbm03036]
    Gbem_0001 (dnaA)
DNA replication proteins [BR:gbm03032]
 Prokaryotic Type
  DNA Replication Initiation Factors
   Initiation factors (bacterial)
    Gbem_0001 (dnaA)
Chromosome and associated proteins [BR:gbm03036]
 Prokaryotic Type
  Nucleoid associated proteins
   Other nucreoid associated proteins
    Gbem_0001 (dnaA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Bac_DnaA Bac_DnaA_C DnaA_N IstB_IS21 AAA_14 AFG1_ATPase AAA ATPase_2 RNA_helicase AAA_19 NTPase_1 Kinesin Peptidase_M15_2 AAA_7 AAA_16
Motif
Other DBs
NCBI-ProteinID: ACH37034
UniProt: B5E7P6
Position
166..1542
Genome map
AA seq 458 aa AA seqDB search
MENIWLEAQTNLKQVLTEQTYSTWIDPLKFLGATVDTIVLEVPSSFFQKWVTDKYLAMIK
EAISAVNGKSYQIEFHVAEEKPEAAHEAKPEKEAKPAREKERDKDKEKEKDREKEKKELV
PNLNPKYTFESFVSGPSNQFAYAASQAVANKPATNYNPLFIYGGVGLGKTHLVNAIGNHI
LAKNPKAKICYYSSEKFMNEMINSLRYKKMDEFRNKFRKMDLLLIDDIQFMAGKEATQEE
FFHTFNALYESHKQIVVTSDKFPKDIPGLEERLRSRFEWGLIADIQPPGVETKVAILKKK
SDMHAVNLPDDVALFLAEGANSNIRELEGMLIRLEAFASLTGQEITLSMAREVMKDIIVE
KTRDITVEMIQKTVAEHFRIKVSELKSDKRIKTLVVPRQIAIYICRELTKASYPEIGEKF
GGKDHSTIIHSVKKIEKQIAGDDEFKATVEDIRKKLFT
NT seq 1377 nt NT seq  +upstreamnt  +downstreamnt
atggaaaatatttggctggaagcccagacaaatcttaagcaagtattaaccgaacagaca
tacagtacgtggatcgacccattgaagtttctgggcgccaccgttgacaccatagtcctc
gaagtccccagttcattctttcaaaagtgggttactgacaaatatctggccatgatcaag
gaagccatctccgcggtcaacggcaaaagctaccagatagagttccatgtcgccgaagag
aagccggaggcagctcacgaggcaaagcccgaaaaagaggccaagcctgccagggagaaa
gaaagggataaggacaaggaaaaagagaaggatagagaaaaggaaaagaaggagctggtt
cccaatctgaaccccaagtacaccttcgagtctttcgtctcgggtcctagcaaccagttc
gcgtatgcagcttcccaggcggtggcgaacaagccggctaccaattacaacccgcttttc
atctacggcggtgtaggtcttggaaagacgcacctggtcaacgccatcggcaaccatatc
ctggccaagaacccgaaggcgaagatctgctattactcctccgaaaagttcatgaacgag
atgatcaactcgctccgctacaagaagatggacgagttccgcaacaagttccggaaaatg
gacctgctgctcatcgacgacatacagttcatggccggaaaagaggccacgcaggaagag
ttcttccacaccttcaatgcgctctacgagtcgcacaagcagatcgtggtcacctccgat
aagttcccgaaggacatcccagggctcgaggagcggttgagaagccgtttcgaatggggg
ctgatcgcggacatccagccaccgggagtggagaccaaagtcgccattctcaagaagaag
tccgacatgcacgcggtcaacctgcccgacgacgtggctctttttctagcggaaggcgcg
aacagcaacatccgcgagttggaagggatgctgatcaggctggaggcgtttgcaagcctc
accggccaggagataacgctcagcatggcccgcgaggtgatgaaggacatcatcgtcgag
aagacccgcgacatcaccgtcgagatgatacagaagaccgtggcggagcacttccgcatc
aaggtatccgaactgaagtccgacaaaaggatcaagaccctcgtggtaccgcgccagata
gcgatctacatctgccgcgagctgaccaaggcgtcctacccggaaataggcgagaagttc
ggggggaaggaccactccaccatcatccactcggtaaaaaagattgagaagcagatcgcg
ggtgacgatgagtttaaggcgactgtggaagacataaggaaaaagctgttcacttaa

DBGET integrated database retrieval system