KEGG   Geobacter bemidjiensis: Gbem_0405Help
Entry
Gbem_0405         CDS       T00749                                 

Gene name
cysG
Definition
(GenBank) precorrin-2 dehydrogenase and sirohydrochlorin ferrochelatase, putative
  KO
K02304  precorrin-2 dehydrogenase / sirohydrochlorin ferrochelatase [EC:1.3.1.76 4.99.1.4]
Organism
gbm  Geobacter bemidjiensis
Pathway
gbm00860  Porphyrin and chlorophyll metabolism
gbm01100  Metabolic pathways
gbm01110  Biosynthesis of secondary metabolites
gbm01120  Microbial metabolism in diverse environments
Module
gbm_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:gbm00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Gbem_0405 (cysG)
Enzymes [BR:gbm01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.76  precorrin-2 dehydrogenase
     Gbem_0405 (cysG)
 4. Lyases
  4.99  Other lyases
   4.99.1  Sole sub-subclass for lyases that do not belong in the other subclasses
    4.99.1.4  sirohydrochlorin ferrochelatase
     Gbem_0405 (cysG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NAD_binding_7 Sirohm_synth_M Shikimate_DH 2-Hacid_dh_C Ku_PK_bind
Motif
Other DBs
NCBI-ProteinID: ACH37434
UniProt: B5EBG5
Position
480893..481567
Genome map
AA seq 224 aa AA seqDB search
MRYYPINVDLHGQSVLIVGGGKVAARKAKRLLAAGARLTVVAPVLVPALAELAEQGTLRH
LERGYRHGDLAGAMLAFAATDDPQLNREVAAEAKERGILADVVDAPAQGAFTTPAVLEQG
DLLITVSTGGASPALSRQIVTMIEPLFGPEYAEAVSLLGTVREKLLTEKVRNAYNDPVFA
ELAALNLPALIKNGQRDVIDQILLKLSATGARPGPDGADKKEPS
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
ttgcgctactacccgataaatgtagacctgcatggccagagcgtgctgatcgtggggggc
gggaaggtcgcggccagaaaggcgaagcggcttttagccgccggcgcccgactcaccgtg
gtcgcgccagtactcgttccggcgcttgcggagcttgccgagcaggggacgctgcggcac
ctggaaagagggtatcgtcacggcgacctggccggggcaatgctcgccttcgccgccacc
gacgatccgcagttgaaccgggaggttgcagccgaggcgaaggagcgcggcatcctggcc
gatgtggtggacgcgccggctcaaggagctttcaccacccccgccgtactggaacagggg
gaccttctgatcaccgtgtctacaggtggtgccagcccggcgctgtcacggcagatcgta
accatgatcgagccccttttcggtcctgaatatgccgaagctgtatcgcttttaggtact
gtccgtgaaaagctattgactgaaaaggtgcggaacgcatacaatgacccggtttttgcc
gaactggcagcgctcaatcttcccgcgctgatcaaaaacgggcagagagatgtaatagac
cagatactcctgaagctctccgctaccggggctcgacctggcccggatggggctgataaa
aaggaaccgtcatga

DBGET integrated database retrieval system