KEGG   Geobacter bemidjiensis: Gbem_0506Help
Entry
Gbem_0506         CDS       T00749                                 

Definition
(GenBank) zinc-dependent oxidoreductase
Organism
gbm  Geobacter bemidjiensis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N_2 ADH_zinc_N ADH_N ADH_N_2 AlaDh_PNT_C ELFV_dehydrog
Motif
Other DBs
NCBI-ProteinID: ACH37535
UniProt: B5ECA7
Position
614908..615861
Genome map
AA seq 317 aa AA seqDB search
MKAVTISRYGGNEVVEVADVPVPTPGEDDVLIKVHAASVNPVDWKIRNGMLKLFTGRSFP
KILGSECAGEVVETGANVRQFKKGDFVIGYPGIKRLAAFAEYVCADKGSTFVKPGNVSSE
EASTLPIAGLTALRALRDLGKVAEGGHVLINGASGGVGTFAVQIAKILGARVTAVCSASN
AALVQDLGADRVLDYAHEDFTKGGERFDVVFDAIAKRSFAECKRAMTAKGVYVSTLPSPS
VLLNQYLTRFFTRKTAKAVMVKPNAADMEWMKKYIEAGKLRVVVDKVFSLEQIKEAFIYS
ESGKAKGKIVVRTGESE
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgaaagctgtgacaataagcaggtatggtggcaacgaagttgtcgaagttgcggatgtg
ccggtgcctactccaggggaagatgacgtactcatcaaggtccatgctgcttcagtgaat
cctgtggactggaagattcgcaacggcatgctgaagctctttaccggacgctcttttcct
aagattctcggcagtgaatgcgctggtgaggtcgttgaaaccggagccaacgtgcggcag
ttcaaaaaaggggattttgtcattggctacccgggaataaaaaggttggctgcctttgct
gagtatgtttgcgctgacaagggaagcacctttgtaaagcccggcaatgtcagctccgag
gaagcatccacgctccccattgccgggctgaccgcattgcgggcgctgcgggacttgggc
aaagttgccgagggtgggcacgtcttgatcaatggcgcgtcgggaggtgtagggacattt
gccgtacagattgcaaagatccttggcgcgcgtgtcaccgccgtatgcagcgccagcaat
gcagccctggtgcaagatctcggtgccgaccgggtgttggattatgcgcacgaggacttc
accaaaggtggcgagaggttcgacgtcgtcttcgacgccattgccaagcgctcgtttgcc
gagtgcaaaagggcgatgacggcaaagggagtctacgtaagcacgcttccgtcaccttcc
gtgctgctgaaccagtacctcacccgatttttcacccggaaaactgcaaaggccgtgatg
gttaagcccaatgccgcggatatggaatggatgaagaaatatatcgaagcaggcaaactc
agggttgtcgttgataaggttttttctctggagcagataaaggaagccttcatctatagt
gaatcgggaaaggctaagggaaagattgttgtcaggacgggcgaaagtgaataa

DBGET integrated database retrieval system