KEGG   Geobacter bemidjiensis: Gbem_0938Help
Entry
Gbem_0938         CDS       T00749                                 

Gene name
rplV
Definition
(GenBank) ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
gbm  Geobacter bemidjiensis
Pathway
gbm03010  Ribosome
Brite
KEGG Orthology (KO) [BR:gbm00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    Gbem_0938 (rplV)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:gbm03011]
    Gbem_0938 (rplV)
Ribosome [BR:gbm03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    Gbem_0938 (rplV)
  Bacteria
    Gbem_0938 (rplV)
  Archaea
    Gbem_0938 (rplV)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: ACH37959
UniProt: B5EFQ5
Position
1100807..1101142
Genome map
AA seq 111 aa AA seqDB search
MESSAKLSSVRLSPRKTRLVVDLVRGKGIQTALNTLRFSPQPSAKLISKLLSSAVANAEQ
KGCSDVDKLFVKTIFVDGGAVLKRFTPRAMGRASKIRKPTSHITVVLAEKK
NT seq 336 nt NT seq  +upstreamnt  +downstreamnt
atggaatcatcggctaaattatcctctgtccgcctctctccgagaaagacacgcctggtc
gtggatctcgtcaggggcaagggcattcagactgcgctgaacactctgcgtttctcaccg
caaccgtcggcgaagctcatctcgaagctcctctcctctgccgtggccaatgccgagcag
aagggttgctccgatgtggacaagctcttcgtcaagacgattttcgtcgatggcggcgca
gtacttaagcgcttcaccccccgcgccatgggccgggccagcaagatcagaaaaccgacg
agccacattaccgtggtccttgcggaaaagaaataa

DBGET integrated database retrieval system