KEGG   Geobacter bemidjiensis: Gbem_1454Help
Entry
Gbem_1454         CDS       T00749                                 

Gene name
oadA
Definition
(GenBank) oxaloacetate decarboxylase
  KO
K01571  oxaloacetate decarboxylase (Na+ extruding) subunit alpha [EC:7.2.4.2]
Organism
gbm  Geobacter bemidjiensis
Pathway
gbm00620  Pyruvate metabolism
gbm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gbm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Gbem_1454 (oadA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:gbm02000]
    Gbem_1454 (oadA)
Enzymes [BR:gbm01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.4  Linked to decarboxylation
    7.2.4.2  oxaloacetate decarboxylase (Na+ extruding)
     Gbem_1454 (oadA)
Transporters [BR:gbm02000]
 Other transporters
  Primary active transporters [TC:3]
   Gbem_1454 (oadA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PYC_OADA HMGL-like Biotin_lipoyl Biotin_lipoyl_2 HlyD_3 HlyD_D23 YqfD
Motif
Other DBs
NCBI-ProteinID: ACH38472
UniProt: B5E7T6
Position
1682090..1684162
Genome map
AA seq 690 aa AA seqDB search
MAKTTKPLGITEVVLRDAHQSLFATRLRLDDMLPIAAKLDQVGYWSIEMWGGATFDSCIR
FLGEDPWERLRELKKAMPNTPQQMLFRGQNILGYRHYADDVVEKFVERSAVNGIDVFRVF
DAMNDPRNLDTAIKAVIKQGKHAQGTLSYTVSPVDTIPKWVALAKRIEDMGAHSLCIKDM
AGLMAPYAAYDLVKALKKGISIPIHMQCHATTGMSTAAYVKAIEAGVENVDTSISSMSMT
YGHSPTETLAAIFADTDKATGLDTVLLQEIADYFTVVRKKYAKFEGSLKGVDARIITAQV
PGGMLTNMESQLKEQNAGHKMDLVLAEIPKVREDLGMIPLVTPTSQIVGTQAVINVLTGE
RYKSMTKETAAVLKGEYGATSAPVNKELQLKVLAGADPITCRPADLLNAEMDKLTEELRG
LSKEKNLKFGDHEVEDVLTYALFQQVGLKFLEHRDNPGMFEPVPTAEDAAPKKAAAPEIT
GGDTYTVTGGGQTFVVQVAKATGAAAAAAAAASAVGGNAPAQAPAAAAGKTIVSPLAGNV
WKIECEPGQQVQEGDLLLILEAMKMENEIFADRDGVVSTIHIEEGTAVDIGAALVTIAGE
GDAAACACAPAATAAAAGPAEGGVMAPLAGNVWKIEVEQGQAVQAGDLLLILEAMKMENE
IFAEKDGVVSRIMIQEGNAVDIGQLLLTVE
NT seq 2073 nt NT seq  +upstreamnt  +downstreamnt
atggccaagacaacgaaaccgttagggataaccgaagtcgtcctcagggacgcccaccag
tccttgttcgcgacccgcctgcgcctggacgacatgcttcccatcgccgccaagttggac
caggtcggctactggtccatcgagatgtgggggggggcgaccttcgactcctgcatccgc
ttcctcggcgaggacccgtgggagcgcctgcgcgagctgaaaaaagcgatgcccaacacg
ccgcagcagatgctgttccgtgggcagaacatcctcggttaccgccactacgcggacgac
gtggtcgagaagttcgtggaacgctccgcggtgaacggcatcgacgtcttccgcgtcttc
gacgccatgaacgacccgcgcaacctcgacaccgccatcaaggcggtgattaaacagggc
aaacacgcccaggggacgctctcctacacggtgagcccggtcgacaccatacccaaatgg
gtggcgctggccaagcgcatcgaggacatgggggcgcactcgctctgcatcaaggacatg
gctgggctcatggccccctacgccgcctacgacctggtcaaggcgctgaaaaaagggatc
tccatcccgatccacatgcagtgccacgccaccaccggcatgtccaccgcggcctacgtg
aaggcgatcgaggcgggggtcgagaacgtcgacacctccatctcctccatgagcatgacc
tacggccattcgcccaccgagacgctcgccgccatcttcgcggacacggacaaggcgacc
ggcctcgacacggtccttttgcaggagatcgccgactacttcaccgttgtgcgcaagaaa
tacgcgaagttcgaaggctccctcaagggtgtagatgcccgcatcatcacggcgcaggtc
cccggcggcatgctcaccaacatggagagccagctcaaggagcaaaacgcggggcacaag
atggacctggtcttggccgagatcccgaaagtccgcgaggacctggggatgatcccgctg
gtcaccccgacctcgcagatcgtcggcacccaggcggtcatcaacgtcctgaccggcgag
cgctacaagtcgatgaccaaggaaaccgccgccgtcctcaaaggggaatacggcgcgacc
tcggccccggtcaacaaggagctgcagctgaaggttctggccggcgccgacccgatcacc
tgccgcccggcggacctcctcaacgcggagatggacaagctcaccgaggagctgcgcggc
ctctccaaggagaagaacctgaagttcggcgaccacgaggtggaggacgtactcacctac
gcgctgttccagcaggttggcctcaagttcctggagcaccgcgacaaccccggcatgttc
gagccggtacccaccgccgaggacgcggcgcccaagaaggcggcagcgcccgaaatcacc
ggcggcgacacctataccgtaaccggcggcggccagaccttcgtggtgcaggtcgccaag
gcgaccggggccgcagcagccgcggctgccgcagcctccgcagttggcggcaacgcaccg
gcgcaggctcccgcagcggcagccggcaagaccatcgtctctcccttggccggcaacgtc
tggaagatcgagtgcgagccgggtcagcaggtgcaggaaggcgatctgctcctcatcctc
gaagccatgaagatggagaacgagatcttcgccgaccgtgacggcgtggtgagcaccatc
cacatcgaggaaggtactgccgtcgacattggcgccgcgctcgtcaccatcgccggcgag
ggcgatgccgcagcctgcgcttgcgctccggccgccacggccgctgccgccggccccgcc
gagggaggtgtcatggcgcctttggccggcaacgtctggaagatcgaggtagagcagggg
caggcggtacaggcaggcgatctgcttctcatcctcgaagcgatgaagatggagaacgag
atcttcgccgaaaaggacggagtcgtcagccggatcatgatccaggaaggaaacgccgta
gacatcggccagcttctgctgaccgtggagtaa

DBGET integrated database retrieval system