KEGG   Geobacter bemidjiensis: Gbem_1460Help
Entry
Gbem_1460         CDS       T00749                                 

Gene name
bamN
Definition
(GenBank) thiolase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
gbm  Geobacter bemidjiensis
Pathway
gbm00071  Fatty acid degradation
gbm00280  Valine, leucine and isoleucine degradation
gbm00310  Lysine degradation
gbm00362  Benzoate degradation
gbm00380  Tryptophan metabolism
gbm00620  Pyruvate metabolism
gbm00630  Glyoxylate and dicarboxylate metabolism
gbm00640  Propanoate metabolism
gbm00650  Butanoate metabolism
gbm00900  Terpenoid backbone biosynthesis
gbm01100  Metabolic pathways
gbm01110  Biosynthesis of secondary metabolites
gbm01120  Microbial metabolism in diverse environments
gbm01130  Biosynthesis of antibiotics
gbm01200  Carbon metabolism
gbm01212  Fatty acid metabolism
gbm02020  Two-component system
Brite
KEGG Orthology (KO) [BR:gbm00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Gbem_1460 (bamN)
   00630 Glyoxylate and dicarboxylate metabolism
    Gbem_1460 (bamN)
   00640 Propanoate metabolism
    Gbem_1460 (bamN)
   00650 Butanoate metabolism
    Gbem_1460 (bamN)
  Lipid metabolism
   00071 Fatty acid degradation
    Gbem_1460 (bamN)
   00072 Synthesis and degradation of ketone bodies
    Gbem_1460 (bamN)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Gbem_1460 (bamN)
   00310 Lysine degradation
    Gbem_1460 (bamN)
   00380 Tryptophan metabolism
    Gbem_1460 (bamN)
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Gbem_1460 (bamN)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Gbem_1460 (bamN)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Gbem_1460 (bamN)
Enzymes [BR:gbm01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Gbem_1460 (bamN)
Exosome [BR:gbm04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Gbem_1460 (bamN)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: ACH38478
UniProt: B5E7U2
Position
1689687..1690862
Genome map
AA seq 391 aa AA seqDB search
MSDVYVIESLRTPLGSFGGALSDVEAPRLAATVITGIMERTGLPAEAIDEVIVGQVLSGG
SGQAPARQAMRYAGLPDTVPALTINKVCGSGLKAIMLGAGSIKLGDAQLVLAGGMENMSL
APYALSKGRYGYRMGNGEMLDLLVHDGLTDPYSGKHMGVIAEQSAGDNKLDRTLQDSFAL
ASYQKAQAALKDGIFNDEIVPVVKKTRQGEVVVREDEEPHKVDFKKLPELRAAFQKDGTI
TAGNASTINDGAAMALLASGEAVAKYGLKPKARLVAYATNSVHPDQFAEAPVGAIAKVCA
KAGLTTDDIDLFEINEAFAAVPLIACQRLRLDPERVNVNGGAVALGHPLGASGARITATL
VRELHKRKQRYGLATLCIGGGEAVAVILERV
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgtcagatgtctatgtcatcgaatcactgcgtaccccgttgggctccttcggcggagcg
ctgagcgacgtagaagcgccgcgtctcgccgccaccgtcatcaccggcatcatggaacgc
acagggcttcccgctgaagccatcgacgaggtgattgtcggccaggttctctccggcggc
tcggggcaggctcccgcgcgtcaggccatgcgctatgcggggctccccgacacggtcccc
gccctcaccatcaacaaggtctgcggctcgggccttaaagccatcatgctcggcgccggt
tccatcaagcttggcgacgcccaactggtgctcgcgggcggcatggagaacatgtcactt
gccccctacgcgctcagcaaaggtcgctacggctaccgcatggggaacggcgagatgctg
gacctgctggtccacgacggcctgaccgacccctacagcggcaagcacatgggggtgata
gcggagcaaagcgccggcgacaacaagctggaccgcaccctccaggacagcttcgcgctc
gcctcctatcagaaggctcaagcggctctgaaagacgggatcttcaacgacgagatagtc
ccggtggtgaagaagacgcgccagggcgaggtggtcgtccgcgaggacgaggagccgcac
aaggtcgacttcaagaaactcccggagctccgcgccgccttccaaaaggacggcaccatc
accgcgggtaacgcctctaccatcaacgacggcgccgccatggcgcttctggcgagcggc
gaggccgtggccaaatacgggctgaagcccaaagcccgcctggtcgcctacgccaccaac
agcgtccatcccgaccagttcgccgaagccccggtaggcgccatcgccaaggtctgcgcc
aaggccgggctcactaccgacgacatcgacctcttcgagatcaatgaggccttcgccgcg
gtcccgctcatcgcctgccaaaggctgcgcctcgatccggagcgcgtcaacgtgaacggc
ggcgcggtggcgctcggccacccgctaggcgcaagcggtgcgcgcatcaccgccaccttg
gtgcgggaacttcacaaacgcaaacaacgctacggtctcgccaccctctgcataggcggc
ggcgaggcggtcgcggtaatcctggaaagggtttag

DBGET integrated database retrieval system