KEGG   Geobacter bemidjiensis: Gbem_2411Help
Entry
Gbem_2411         CDS       T00749                                 

Gene name
putA
Definition
(GenBank) proline dehydrogenase and Delta-1-pyrroline-5-carboxylate dehydrogenase
  KO
K13821  RHH-type transcriptional regulator, proline utilization regulon repressor / proline dehydrogenase / delta 1-pyrroline-5-carboxylate dehydrogenase [EC:1.5.5.2 1.2.1.88]
Organism
gbm  Geobacter bemidjiensis
Pathway
gbm00250  Alanine, aspartate and glutamate metabolism
gbm00330  Arginine and proline metabolism
gbm01100  Metabolic pathways
gbm01110  Biosynthesis of secondary metabolites
gbm01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:gbm00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Gbem_2411 (putA)
   00330 Arginine and proline metabolism
    Gbem_2411 (putA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:gbm03000]
    Gbem_2411 (putA)
Enzymes [BR:gbm01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.88  L-glutamate gamma-semialdehyde dehydrogenase
     Gbem_2411 (putA)
  1.5  Acting on the CH-NH group of donors
   1.5.5  With a quinone or similar compound as acceptor
    1.5.5.2  proline dehydrogenase
     Gbem_2411 (putA)
Transcription factors [BR:gbm03000]
 Prokaryotic Type
  Ribbon-helix-helix
   Other families
    Gbem_2411 (putA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh Pro_dh PutA_N DUF4910
Motif
Other DBs
NCBI-ProteinID: ACH39421
UniProt: B5EFV6
Position
complement(2791465..2794479)
Genome map
AA seq 1004 aa AA seqDB search
MNNSELNNRVVARGKEFFSTISGEKPSLFNKGAWMGKVMDWSMQNETFKIQMFRFVDVFP
SLTTGKLLTDHIREYFGEEKDMPPVLSTGAKVAGMLGSFGGAVLNKFLTTNIQEMARQFI
VGENTKEAIKNMERLRKDGFAFVVDVLGEATLSEKEADIYMNTYLELLDSLKKEYKDWKP
LPGRGGEAGLDWGHAPKVNVAVKPTALFCLANPQDFEGSVVAILERVRKIAVKVMELNGF
LCIDMESYRHKDIIIEVYKRLKLEYPAYPHFGLVLQAYLVDTDKDLPELLAWARQNKVQI
SIRLVKGAYWDYETVKAKQNDWKVPVWTIKAESDAAYERQARMILESSDICHFACASHNI
RTISAVMEMAKELNVPDERYEFQVLYGMAEPVRKGILKVAGRIRLYCPYGDMVPGMGYLV
RRLLENTANESFLRQSFAEDAQIEKLLEDPEVTAERERKARAAKHKAIAKGPGNLAPFNN
EAMVDFTRADHRAAFPKQIAEVRKQLGKTYPLFVNGKEVKTGDTIASVNPNNPSETVGIV
CQAGTKEVGDAIAAAKGAFPAWRDTDIKLRAEYLVKAAAAARRRIFELSAWQVLEIGKQW
DQAYADVCEAIDFLEYYAREMIALGAPKRIGHAPGELNHYFYEPKGVAAVISPWNFPLAI
SMGMVSAAIVAGNCVVFKPSGLTSVIGYHIVELFREVGLPDGVFNYTPGRGSVMGDYLVD
SPDISLIAFTGSMEVGLRIIERAAKVYPGQENVKKIVCEMGGKNAIIIDDDADLDEAVPH
VLYSAFGFQGQKCSACSRVIVLDAVYDKFVERLVSMAQATLVGPSEDPAHYMGAVADDKA
MKTIKEYAEIGKKEGQLLYESKVPADGGYYVPMTIIGGIKPEHRIAQEEIFGPVLAVMRA
KDFDQAIAWANSTKFALTGGVFSRSPEHLAQARKEFRVGNLYLNRNNTGALVGRQPFGGS
KMSGVGTKAGGHDYLLHFMDPRVVTENTMRRGFAPVEEDDDWVA
NT seq 3015 nt NT seq  +upstreamnt  +downstreamnt
atgaataacagcgaactgaacaatcgagttgtggcaaggggcaaggagtttttctcgacc
atctccggcgagaagccgtctctctttaataagggcgcctggatgggcaaggtcatggat
tggagcatgcagaacgagacctttaagatccagatgttccgcttcgtcgacgtcttcccg
tctctcaccaccgggaaactgctgacggaccacatccgcgaatacttcggcgaggagaag
gatatgcctccggttctctccaccggcgccaaggtggcgggcatgctcggctccttcggc
ggtgcggtcctcaacaagttcctcaccaccaacattcaggagatggcccgtcagttcata
gtcggggagaacacgaaggaagcgatcaagaacatggagcgcctgagaaaggacggcttc
gccttcgtcgtggacgtgctgggcgaggcgacgctttcggagaaggaagcggatatctac
atgaacacctacctggagcttctggactcgctcaagaaggaatataaggactggaaaccg
ctgccgggcaggggaggggaggccggcctcgattggggtcacgctccaaaggtgaacgtt
gcggtcaaaccgacggcgcttttctgcctcgccaacccgcaggacttcgagggctcggtg
gtcgccattctggagcgcgtgcgcaagatcgcggtgaaggtcatggagctgaacggcttc
ctctgcattgacatggagtcttaccgccacaaggacatcatcatcgaagtctacaaaagg
ctgaagctcgagtacccggcatacccccatttcggcctcgtgctccaggcatacctggtg
gacaccgacaaggaccttcccgaactcctcgcctgggcgcgccagaacaaggtgcagatc
tcgattcgcctggtgaagggggcgtactgggactatgaaaccgtgaaggccaagcagaac
gactggaaggttccggtctggaccatcaaggcggagtcggatgcggcttacgagcgacag
gccaggatgatcctggaaagctccgacatctgccacttcgcctgcgcctcgcacaacatc
aggaccatctcggcggttatggagatggccaaagagctgaacgtgccggacgagcgctac
gagttccaggtgctttacgggatggcggagccggtccgcaaggggatactgaaggttgcc
ggccgcatccgcctctactgcccgtatggcgacatggtccccggcatggggtacctggtc
cggcgtctgctggagaacacggcaaacgagtccttcctgcgtcagagcttcgccgaggac
gcgcagatcgagaaactcctggaggacccggaggtgaccgccgagcgtgagcgtaaagcg
cgcgccgcgaagcacaaggctatagcgaaaggccccggcaacctggcgccattcaacaac
gaggcgatggtggacttcaccagggccgaccatcgcgctgcgttcccgaaacagatagcg
gaggtgaggaagcagttgggcaaaacctacccgctcttcgtcaacgggaaggaagtgaag
accggcgacaccatcgcctcggtcaacccgaacaacccttcggaaacggtcggcatcgtc
tgccaggcggggaccaaggaagtgggcgatgcaatcgccgccgccaagggtgctttcccg
gcatggcgcgacaccgacatcaagctccgcgccgagtacctcgtcaaggctgccgccgcg
gcgcgccgcaggatcttcgaactctccgcatggcaggtgctggagataggcaagcagtgg
gaccaggcctacgccgacgtctgcgaggcgatcgacttcctcgagtactacgcccgcgag
atgattgccttgggcgcccccaagcgcatcggccacgcgccgggcgaattgaaccactac
ttctacgagcccaaaggggtggccgcggtaatctctccgtggaacttcccgctggcgatc
agcatgggcatggtttcggcggcgatcgttgccggcaactgcgtggtcttcaaaccctcc
ggccttacctcggtcatcggctaccacatcgtggaactcttccgcgaggtaggccttccc
gacggcgtcttcaactacacccccggccgcggctcggtgatgggggattacctggtcgac
agccctgacatcagcctgatcgccttcaccggatcgatggaagtcggtctgcgcataatc
gagcgcgccgccaaggtgtatcctgggcaggagaacgtgaagaagatcgtctgcgagatg
ggaggcaagaacgccatcatcatcgacgatgacgccgacctggacgaggcggtgccgcac
gtgctctactccgccttcggcttccaagggcagaagtgctccgcatgctcccgcgtcatt
gtcctcgacgcggtctatgacaagttcgtggagcgcctggtctccatggcccaggcgacg
cttgtcggcccctctgaggacccggcccactatatgggtgccgtagccgacgacaaggcg
atgaagaccatcaaggaatacgcggagatcggcaagaaggagggtcagctcctttacgag
agcaaggtcccggccgacggcggctattacgtcccgatgaccatcatcggcggcatcaag
cccgagcacaggatcgcgcaggaagagatcttcggaccggtcctggccgtcatgcgcgcc
aaggacttcgaccaggccatcgcctgggccaactccaccaagttcgcactgaccggcggc
gtcttctccagaagccccgaacatctggcgcaggctcgcaaggaattccgggtcggcaac
ctgtacttaaaccgcaacaacaccggcgccctcgtcggccgccagcccttcggcggctcc
aagatgtccggcgtcggcaccaaggctggcggacatgactacctgctgcacttcatggac
cccagggtcgtcaccgagaacaccatgcgccgcggcttcgcaccggtcgaggaggacgac
gactgggtcgcataa

DBGET integrated database retrieval system