KEGG   Geobacter bemidjiensis: Gbem_2835Help
Entry
Gbem_2835         CDS       T00749                                 

Definition
(GenBank) thiolase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
gbm  Geobacter bemidjiensis
Pathway
gbm00071  Fatty acid degradation
gbm00280  Valine, leucine and isoleucine degradation
gbm00310  Lysine degradation
gbm00362  Benzoate degradation
gbm00380  Tryptophan metabolism
gbm00620  Pyruvate metabolism
gbm00630  Glyoxylate and dicarboxylate metabolism
gbm00640  Propanoate metabolism
gbm00650  Butanoate metabolism
gbm00900  Terpenoid backbone biosynthesis
gbm01100  Metabolic pathways
gbm01110  Biosynthesis of secondary metabolites
gbm01120  Microbial metabolism in diverse environments
gbm01130  Biosynthesis of antibiotics
gbm01200  Carbon metabolism
gbm01212  Fatty acid metabolism
gbm02020  Two-component system
Brite
KEGG Orthology (KO) [BR:gbm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Gbem_2835
   00630 Glyoxylate and dicarboxylate metabolism
    Gbem_2835
   00640 Propanoate metabolism
    Gbem_2835
   00650 Butanoate metabolism
    Gbem_2835
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Gbem_2835
   00072 Synthesis and degradation of ketone bodies
    Gbem_2835
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Gbem_2835
   00310 Lysine degradation
    Gbem_2835
   00380 Tryptophan metabolism
    Gbem_2835
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Gbem_2835
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Gbem_2835
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Gbem_2835
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:gbm04147]
    Gbem_2835
Enzymes [BR:gbm01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Gbem_2835
Exosome [BR:gbm04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Gbem_2835
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: ACH39839
UniProt: B5EID7
Position
complement(3261476..3262651)
Genome map
AA seq 391 aa AA seqDB search
MKDIFVVESQRTPFGSFGGVLSDVEATVLGGGAIKALLERTGLDPAEVDEVIAGQVLSGG
CGQAPARQAMRGAGIPDSAHAMTINKVCGSGLKAIMLGAGSIQLEDSEIVVAGGMENMSL
APFLLKKARYGYRMGHGSLIDLMIYDGLQDPYSGRHMGEIAEASVKKHGLTREAQDEFTL
RSYKLAQDAVRGGVFKDEIAPVVKKGRKGDEVISDDEEPFKVDFDKLTQLRPVFSKDGTI
TAANASSINDGAAFTLLAGESALKRCNLTPKARVVAYATGSLHPELYTEAPVTAIQAACA
RAGLKVGDIDLFEINEAFAAVTMIAMKELDLNPAKVNVNGGACALGHPIGASGARLAGTL
IRELHKRQARYGLATLCIGGGEAVAVIFERV
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgaaagacatctttgtcgttgagtcgcagagaaccccgttcggatctttcggcggcgtt
ctctcggatgttgaggctacggtccttggggggggcgccatcaaggctctcctggagcgg
accggcctggacccggccgaggtcgacgaggtcatcgccgggcaggttctttccggcggc
tgcgggcaggctcctgcgcgccaggcgatgcgcggcgccgggatcccggacagcgcccat
gccatgaccatcaacaaggtctgcggcagcggcttaaaagcgatcatgctgggggcaggc
tccatccagctggaagattccgaaatcgttgtggccggcggcatggaaaacatgtccctc
gcgccctttctgctcaagaaggcgcgctacggctaccgcatggggcacggctcgctcatc
gacctgatgatttacgacggcctgcaggacccatactccgggcggcacatgggagagatc
gccgaggcttcggtgaaaaagcatgggctcacccgcgaggcgcaggacgaattcacgctg
cgctcctacaagctggcccaggacgcggtgcgcggcggggtcttcaaggacgagatcgcg
ccggtggtgaaaaaagggcgcaagggggacgaggtgatctcggacgacgaggagccgttc
aaggtggacttcgacaagctgacgcagttgaggccggtgttcagcaaggacgggaccatc
accgccgccaacgcctccagcatcaacgacggcgcagccttcacgctcctggctggggag
tcggcgctgaagcgctgcaaccttaccccgaaggcgcgcgtggttgcctacgccaccggt
agcctgcacccggagctctacaccgaagcccccgtgacggcgatccaggcggcctgcgcc
agggccggactgaaagtgggggacatcgacctcttcgagatcaacgaagctttcgccgcg
gtgaccatgattgccatgaaagaacttgatttgaaccccgccaaagtcaacgtcaacggc
ggagcctgcgccctggggcaccccatcggcgcgagcggcgcacggcttgccgggacgctg
atccgggagctgcacaagcggcaggcgcgctatgggctcgccacgctctgcatcgggggc
ggcgaggcggtcgcggtcattttcgaaagggtctag

DBGET integrated database retrieval system