KEGG   Geobacter bemidjiensis: Gbem_3234Help
Entry
Gbem_3234         CDS       T00749                                 

Gene name
pfk-4
Definition
(GenBank) 6-phosphofructokinase, putative
  KO
K16370  6-phosphofructokinase 2 [EC:2.7.1.11]
Organism
gbm  Geobacter bemidjiensis
Pathway
gbm00010  Glycolysis / Gluconeogenesis
gbm00030  Pentose phosphate pathway
gbm00051  Fructose and mannose metabolism
gbm00052  Galactose metabolism
gbm00680  Methane metabolism
gbm01100  Metabolic pathways
gbm01110  Biosynthesis of secondary metabolites
gbm01120  Microbial metabolism in diverse environments
gbm01130  Biosynthesis of antibiotics
gbm01200  Carbon metabolism
gbm01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:gbm00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Gbem_3234 (pfk-4)
   00030 Pentose phosphate pathway
    Gbem_3234 (pfk-4)
   00051 Fructose and mannose metabolism
    Gbem_3234 (pfk-4)
   00052 Galactose metabolism
    Gbem_3234 (pfk-4)
  Energy metabolism
   00680 Methane metabolism
    Gbem_3234 (pfk-4)
Enzymes [BR:gbm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Gbem_3234 (pfk-4)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PfkB Phos_pyr_kin
Motif
Other DBs
NCBI-ProteinID: ACH40231
UniProt: B5E9Q7
Position
complement(3725707..3726642)
Genome map
AA seq 311 aa AA seqDB search
MKTIVTITMNPAIDKSATVDHVVAERKLYCSEPLFEPGGGGINVSRAVRKLGGESLALYP
SGGHSGQTLRLLLDQEGLTHRPIEVAGWTRENLIVLESATGQQYRFGMPGPDLSAKEWQA
CLEQIFAGGARPDYLVASGSLPPGVPQDFYARIARLGKQHGARVVVDASGEPMRLALREG
VFLIKPNIREFREMIGEGGEDEARVLALAKKIVLDGQSEVVVISLGAAGVLMVSDSGVER
LHPPTVPIISKVGAGDSMVAGMVLSLARGNTLRDAVRFGVAAGTAAVMTPGTELCRREDA
ERLYRQMLPGE
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacgatcgtgaccataaccatgaatcctgccatcgataagagtgcgacggtggat
catgtggtggcagaaagaaagctttattgcagcgagccccttttcgagcctgggggaggg
gggatcaacgtctcgcgggcagtgcggaagcttggcggggagtccctggctctttatccg
tcgggagggcacagcggacagacgctgcgcttgctgctcgatcaggaagggcttacgcac
cgtccgattgaggtcgccggctggaccagggagaacctgatcgtgctggagtccgcaacg
gggcagcagtaccgcttcgggatgcctgggccggatctttccgccaaggagtggcaggct
tgcctggaacagatctttgccggcggagcaaggcccgattacctggtggcgagcggcagc
ctccctccgggcgtaccgcaggacttttatgcccggatagcgcgccttggaaagcagcac
ggcgcccgggtggtggtggacgcttcgggcgagcccatgcgcctggcgctgcgcgaggga
gtcttcctgatcaagccgaacatccgggagtttcgcgagatgataggcgaggggggggaa
gacgaagccagggtgctggcgcttgccaagaagattgtcctggatgggcagagcgaggtg
gtggtgatctcgctcggcgcggccggggttctcatggtgtcggactcgggagtggagcgg
ctgcatccccccacggttcccattatcagcaaggtcggcgccggtgactccatggtggcc
ggcatggtattgagccttgcgcgggggaataccctgcgtgacgccgtccgtttcggggtg
gctgccgggaccgccgcggtgatgacgcccggaacggaactctgccgccgggaggatgcc
gagaggctgtaccggcagatgcttccgggcgaatag

DBGET integrated database retrieval system