KEGG   Geobacter bemidjiensis: Gbem_3781Help
Entry
Gbem_3781         CDS       T00749                                 

Definition
(GenBank) phosphate/sulfate transporter family membrane protein
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
gbm  Geobacter bemidjiensis
Brite
KEGG Orthology (KO) [BR:gbm00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    Gbem_3781
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4 Col_cuticle_N Myc_target_1 LapA_dom
Motif
Other DBs
NCBI-ProteinID: ACH40773
UniProt: B5EEI7
Position
complement(4318157..4319158)
Genome map
AA seq 333 aa AA seqDB search
MPEVTLVLLVAVIAAALLFDYINGFHDTANAIATCVSTRALTVRTAIFMAAGLNFVGAMI
STKVAATIGKGIVDANNITQVVVLAGILGAIIWNLITWYYGLPSSSSHAIIGGLAGSVVA
HAGTSALHWAGLKKIITVLILSPVVGAFFGFLFMVIMMWTFRNKAPYTLNKVFRKLQILS
AAVMAFSHGTADAQKSMGVITMALVSYGSLATFEVPNWVKLSCAVAMGLGTAAGGWRIIK
TVGHDFVKLQPVHGFCVETASAAVILGASAMGLPTSTTHVITSSILGVGLTKRISAVNWG
VASRIVTAWVITIPASASVGFVSYMVFSPFLGK
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atgcctgaggtcacattagtcttgctggttgcggtaatagccgcggcgcttctgttcgac
tacataaacggcttccacgatacggccaacgccatcgccacctgcgtttccacccgcgcc
ctcacggtcaggaccgccatcttcatggctgccggcctcaacttcgtcggggccatgatc
tcgaccaaggtggccgcgaccatagggaaggggatcgtggacgccaacaatatcacccag
gtggtggtgctggccgggatcctgggggcgatcatctggaacctgatcacctggtactac
ggccttccctcctcctcctcgcacgccatcatcggcgggctggcgggttcggtcgtggcg
catgccggcacctccgcgctgcactgggccgggttgaagaagatcatcaccgtgctgatt
ctctccccggtggtcggcgccttcttcggctttctcttcatggtcatcatgatgtggacc
ttcaggaacaaggccccctacacgctcaacaaggtgttccgcaagctgcagatcctctcc
gcagccgtcatggccttctcccacggcactgccgacgcgcagaagtccatgggggtcatc
accatggcgctggtcagctacggcagcctcgctaccttcgaggttcccaactgggtgaag
ctttcctgtgcggttgccatgggtcttggcacggcggcgggcggttggaggatcatcaag
acggtggggcacgatttcgtcaagctgcagccggtgcacggcttctgcgtcgagaccgct
tcggcggcggttatcctgggcgcttccgccatggggcttcccacctcgaccacgcacgtg
atcacctcgtccatcctgggggtggggctgaccaagaggatctccgccgtcaactggggt
gtcgcctcccgcatcgtcacggcctgggtcatcaccataccagcctcggcaagcgtcggc
tttgtgagctacatggtattctcgccgtttcttgggaagtaa

DBGET integrated database retrieval system