KEGG   Gordonia bronchialis: Gbro_0491Help
Entry
Gbro_0491         CDS       T01102                                 

Definition
(GenBank) Enoyl-CoA hydratase/isomerase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
gbr  Gordonia bronchialis
Pathway
gbr00071  Fatty acid degradation
gbr00280  Valine, leucine and isoleucine degradation
gbr00281  Geraniol degradation
gbr00310  Lysine degradation
gbr00360  Phenylalanine metabolism
gbr00362  Benzoate degradation
gbr00380  Tryptophan metabolism
gbr00410  beta-Alanine metabolism
gbr00627  Aminobenzoate degradation
gbr00640  Propanoate metabolism
gbr00650  Butanoate metabolism
gbr00903  Limonene and pinene degradation
gbr00930  Caprolactam degradation
gbr01100  Metabolic pathways
gbr01110  Biosynthesis of secondary metabolites
gbr01120  Microbial metabolism in diverse environments
gbr01130  Biosynthesis of antibiotics
gbr01212  Fatty acid metabolism
Module
gbr_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:gbr00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Gbro_0491
   00650 Butanoate metabolism
    Gbro_0491
  Lipid metabolism
   00071 Fatty acid degradation
    Gbro_0491
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Gbro_0491
   00310 Lysine degradation
    Gbro_0491
   00360 Phenylalanine metabolism
    Gbro_0491
   00380 Tryptophan metabolism
    Gbro_0491
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Gbro_0491
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Gbro_0491
   00281 Geraniol degradation
    Gbro_0491
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Gbro_0491
   00627 Aminobenzoate degradation
    Gbro_0491
   00930 Caprolactam degradation
    Gbro_0491
Enzymes [BR:gbr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Gbro_0491
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: ACY19821
UniProt: D0LDK1
Position
543109..543891
Genome map
AA seq 260 aa AA seqDB search
MGTSSHDRPVTVRTDGPVTIVGINRPEVRNAVDRVTAEALADAFGSFDADHAQSVAVLYG
EGGTFCAGADLKAIASGGGNRVAVDGDAPMGVSRMRMSKPVIAAIAGHAVAGGLELALWA
DLRVAEEDAVFGVFCRRWGVPLIDGGTVRLPRLIGRSRAMDLILTGRPVSAAEALDIGLA
NRVVPHGESLDRAVELARELSEFPQTCLRHDRLSLLEQGGFDEADAMRNEFAHGMESLAA
DAVSGAARFADGAGRHGDRA
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
gtggggacgagtagtcacgaccgtcccgtcacggtccgcaccgacgggccggtcaccatc
gtcgggatcaatcggcccgaggtgcgcaacgccgtcgaccgcgtcaccgccgaggcgctg
gccgacgcgttcggctccttcgacgccgaccacgcgcaatcggtcgccgtcctctacggc
gagggcggaaccttttgtgccggggcagatctgaaggcgatcgcatcagggggcggcaat
cgggttgccgtcgatggtgatgcgccgatgggggtctcgcggatgcggatgtccaaaccg
gtgatcgcggcgatcgccgggcatgcggtggccggggggctcgaactcgcgttgtgggcc
gatcttcgggtcgccgaggaggacgcggtgttcggcgtgttctgccgacgctggggtgtg
ccgctgatcgacggcggcaccgttcggctgccgcggctcatcgggcgcagtcgcgcgatg
gacctgatcctcaccggacggccggtgtccgcggccgaggcactcgacatcgggctcgcg
aaccgggttgtgccgcacggtgaatcgttggaccgcgcggtcgagctcgcccgcgagttg
agtgagttcccgcagacgtgtctgcggcacgaccggctgtcgttgctggagcagggcggc
ttcgacgaggccgacgccatgcgtaacgagttcgcgcacgggatggaatcgcttgccgcg
gatgcggtatcaggtgcggcgagattcgccgacggtgcggggcggcacggcgatcgggcg
tga

DBGET integrated database retrieval system