KEGG   Gordonia bronchialis: Gbro_0586Help
Entry
Gbro_0586         CDS       T01102                                 

Definition
(GenBank) Pterin-4a-carbinolamine dehydratase-like protein
  KO
K01724  4a-hydroxytetrahydrobiopterin dehydratase [EC:4.2.1.96]
Organism
gbr  Gordonia bronchialis
Pathway
gbr00790  Folate biosynthesis
gbr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gbr00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Gbro_0586
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:gbr04147]
    Gbro_0586
Enzymes [BR:gbr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.96  4a-hydroxytetrahydrobiopterin dehydratase
     Gbro_0586
Exosome [BR:gbr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Gbro_0586
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyoxalase_6 Pterin_4a
Motif
Other DBs
NCBI-ProteinID: ACY19914
UniProt: D0LEJ6
Position
623217..623894
Genome map
AA seq 225 aa AA seqDB search
MTGSSGTPVSAAAATEVVSDPWRVLADKLVAAYQTGSMVKGGEFVARIIDAAEAAGHHPD
IDLRYGTVHLVLTTHSAHQLTEADVALANTIAQIASELGIEPSGTSVAQVDIAIDALDIA
AIRPFWTAVLGFRDAAESEPIDLVDPDGRLPGVWFQQMDEARPQRNRIHLDVLVPHDVVH
ERLQAALTAGGQLLSDEYAPAFWVLADAEGNEACLCTWQGRNSER
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
atgaccggatccagtggaaccccagtcagtgccgccgccgcaaccgaggtggtctccgac
ccctggcgcgtcctcgccgacaaactcgtcgccgcttaccagaccggctcgatggtcaag
ggaggcgagttcgtcgccaggatcatcgacgccgcagaggccgcaggccaccaccccgac
atcgaccttcgttacggcacagtgcatctggtgttgacgacgcacagtgcgcatcagctc
accgaagccgacgtggcgctcgcgaacaccatcgcgcagatcgcgtccgaactcgggatc
gagccgtccggtacatcggtggcccaggtggacatcgccatcgatgccctcgacatcgcc
gccatccgtcccttctggacagcggtgctcgggtttcgcgatgccgccgagtccgagccg
atcgacctggtcgacccggacggccgtttacccggggtgtggttccagcagatggacgag
gcccgtccgcaacgcaatcgcatccacctcgacgtcctggttccgcacgacgtggtgcat
gaacgcctgcaggccgcgctcaccgcaggtgggcaactgctcagcgacgagtacgcaccg
gcgttctgggtgctcgccgacgccgagggcaacgaggcgtgcctgtgcacctggcagggg
cggaacagcgagcgatag

DBGET integrated database retrieval system