KEGG   Gordonia bronchialis: Gbro_1490Help
Entry
Gbro_1490         CDS       T01102                                 

Definition
(GenBank) methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
gbr  Gordonia bronchialis
Pathway
gbr00450  Selenocompound metabolism
gbr00970  Aminoacyl-tRNA biosynthesis
gbr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gbr00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    Gbro_1490
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Gbro_1490
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:gbr01007]
    Gbro_1490
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:gbr03016]
    Gbro_1490
Enzymes [BR:gbr01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     Gbro_1490
Amino acid related enzymes [BR:gbr01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   Gbro_1490
Transfer RNA biogenesis [BR:gbr03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    Gbro_1490
 Prokaryotic type
   Other AARSs
    Gbro_1490
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA-synt_1e tRNA-synt_1f Anticodon_1
Motif
Other DBs
NCBI-ProteinID: ACY20768
UniProt: D0L6Y3
Position
complement(1553894..1555465)
Genome map
AA seq 523 aa AA seqDB search
MAADLTSRNSHGDGRPYYITTAIAYPNGAPHIGHAYEYISADVLARFHRLDGYDVRFLTG
TDVHGQKMQQTAEKEGIPTAELARRNSDRFQALQDRLGSSYHRFIRTSDDDHKRASEAIW
QRMSDNGDIYLDKYSGWYDVRDETFYADSETSVNEAGERVATDTGHVLTWTEEETYFFRL
SNYQDKLLELYESDPDFIGPDVRRNEVVSFVKGGLNDLSISRTTFDWGVPVPAHPDHVMY
VWVDALTNYLTGAGFPDDEQTLRRYWPADLHIIGKDIIRFHCVYWPAFLMSAGIDLPKRV
FVHGFLLNKGEKMSKSVGNVLDPDALIAEFGLDPVRYFFLREVSYGQDGSYSTDAIISRI
NADLANDFGNLAQRTLSMIGKYFDGALPAPGVYLDADTELLARADALLDTVRAHIEVQAI
HLALEAMWSVLGETNRYISAQEPWKLAKTDLGRTGTVLYVCAEVVRIVALLSQPVMPAST
AKLLDLLGVDDSGAARQFSAVTDRLAPGTTLPKPTPIFPRYEV
NT seq 1572 nt NT seq  +upstreamnt  +downstreamnt
atggccgcagacttgaccagccgcaattcgcacggtgacggacgcccgtactacatcacc
accgcgatcgcctaccccaacggcgcacctcacatcgggcacgcctatgagtacatctcg
gccgacgtgctcgcccggttccaccgcctcgacggctacgacgtccggtttctcaccggc
actgacgtccacggccagaagatgcagcagaccgcggaaaaggaaggcatcccgaccgcc
gagctggcgcgccgcaactccgaccgattccaggccctgcaggaccggctcggctcgagt
tatcaccggttcatccgcacctccgacgacgaccacaagcgcgcgtcggaggccatctgg
cagcggatgagcgataacggcgacatctacctcgacaagtactccggctggtacgacgtc
cgcgacgagaccttctacgccgacagcgagaccagcgtcaacgaggcaggcgaacgcgtc
gccaccgacaccggacacgtcctcacctggaccgaggaggagacctacttcttccggctg
tccaactaccaggacaagctcctcgagctctacgagtccgaccccgacttcatcggaccc
gacgtccgccgcaacgaggtggtcagcttcgtcaagggcggcctcaacgacctgtccatc
tcgcgcaccaccttcgactggggagtaccggtccctgctcaccccgatcacgtcatgtac
gtgtgggtcgacgccctcaccaactacctgaccggcgccggcttccccgacgacgagcag
acgctgcgccgctactggccggccgatctgcacatcatcggcaaggacatcatccgcttc
cactgcgtgtactggcccgctttcctgatgagcgcgggcatcgatctgcccaaacgtgtg
ttcgtgcacggctttttgctgaacaagggcgagaagatgagcaagtcggtgggcaacgtc
ctcgatcccgacgcactgatcgccgagttcggactcgaccccgtgcggtacttcttcctg
cgtgaggtctcctacggtcaggacgggtcgtactcgaccgacgcgatcatcagccggatc
aacgccgacctcgccaacgacttcggcaacctcgcgcaacgcaccttgtcgatgatcggc
aagtacttcgacggggcgctgcccgctccgggggtctacctcgacgccgataccgaactc
ctcgcccgcgccgatgccctgctcgacaccgtgcgcgcccacatagaggtccaggccatc
catctcgcgctcgaggcgatgtggtcggtcctcggggagaccaaccgctacatctcggcg
caggaaccgtggaagctcgccaagaccgacctcggacgcaccggcaccgtgctctacgtc
tgcgccgaggtggtccgcatcgtcgcactgctcagccaaccggtcatgccggcctccacg
gcgaagctgctcgacctgttgggcgtcgacgattccggtgccgcccggcagttcagcgcc
gtcaccgaccggctcgctcccgggaccacgctcccgaagccgacgccgatcttcccccgc
tacgaggtctga

DBGET integrated database retrieval system