KEGG   Gordonia bronchialis: Gbro_1777Help
Entry
Gbro_1777         CDS       T01102                                 

Definition
(GenBank) Succinate dehydrogenase hydrophobic anchor subunit-like protein
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
gbr  Gordonia bronchialis
Pathway
gbr00020  Citrate cycle (TCA cycle)
gbr00190  Oxidative phosphorylation
gbr00650  Butanoate metabolism
gbr01100  Metabolic pathways
gbr01110  Biosynthesis of secondary metabolites
gbr01120  Microbial metabolism in diverse environments
gbr01130  Biosynthesis of antibiotics
gbr01200  Carbon metabolism
Module
gbr_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:gbr00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Gbro_1777
   00650 Butanoate metabolism
    Gbro_1777
  Energy metabolism
   00190 Oxidative phosphorylation
    Gbro_1777
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt Ferric_reduct Cation_ATPase_C CybS
Motif
Other DBs
NCBI-ProteinID: ACY21035
UniProt: D0L8L8
Position
complement(1855023..1855484)
Genome map
AA seq 153 aa AA seqDB search
MSAPEATQHLAKTLGTDYDRPASLDNPRSPRKSKGGNFEKNAWMFMRFSGLALIILTIGH
MFIMLAWDSQGVHRIDAAFVLERWSSPFWQIWDLSMLWLAQLHGGNGVRTVIADYSRKDS
TRFWLNVLLGVSMILILVLGTYAILTIGAVDAD
NT seq 462 nt NT seq  +upstreamnt  +downstreamnt
atgagcgccccggaagccacgcagcacctcgccaagacgctgggcaccgattacgatcgg
ccggccagcctcgacaatccgcgttcgccgcgcaagtccaagggcggcaacttcgagaag
aacgcatggatgttcatgcgcttctccggcctcgccctcatcatcctcaccatcggccac
atgttcatcatgttggcgtgggacagccagggggtgcaccgcatcgacgcggcattcgtg
ctcgaacgctggagctcgccgttctggcagatctgggacctctcgatgctctggctggcc
cagttgcacggcggtaacggagtgcggacggtgatcgccgactattcccgcaaggactcg
acccgcttctggctcaacgtcctgctcggggtgtcgatgatcctcatcctcgttctcggc
acctacgcgatcctcaccatcggcgcggtcgacgccgactaa

DBGET integrated database retrieval system