KEGG   Gordonia bronchialis: Gbro_1945Help
Entry
Gbro_1945         CDS       T01102                                 

Definition
(GenBank) Glutaminase
  KO
K01425  glutaminase [EC:3.5.1.2]
Organism
gbr  Gordonia bronchialis
Pathway
gbr00220  Arginine biosynthesis
gbr00250  Alanine, aspartate and glutamate metabolism
gbr00471  D-Glutamine and D-glutamate metabolism
gbr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gbr00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Gbro_1945
   00220 Arginine biosynthesis
    Gbro_1945
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    Gbro_1945
Enzymes [BR:gbr01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     Gbro_1945
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glutaminase STAS STAS_2
Motif
Other DBs
NCBI-ProteinID: ACY21199
UniProt: D0L9L1
Position
2052176..2053627
Genome map
AA seq 483 aa AA seqDB search
MASHVGGYLRHIMDTCAQNRSGQVADYIPELAAVDPDGYGLSLCVHDGHTYSCGDSDHEF
TIQSVSKPLTYAMVLSRLGAVAADPKIGVEPSGEAFNEISVDARRRPRNPMINAGAIMSA
SLLLPPVRDVAESVIVSTFAEIVDFYSACAGRRLTMDEAVYTSESRTGSRNRAIAYMLDS
FGTLDTSPDAALDLYYRQCSIRVTTDDLAVIAATIANGGLNPRTGRHVFNQEVAQRVLSV
MTTCGMYDGAGDWVTSVGLPAKSGVGGAIMAVLPGQLGIGVYSPRLDEHGNSVRGGETCR
HLSTDLGLHMFNVTRESRVTIRAVYDISDVPVGTEWSEQERGFLRTCRDRVRVYELQGDL
TFGGAESALRRLETDMDDFVVAIVEISRIGVIDPVARTMILSMKRTLEERGRQAMLVDPD
GVMRDSVDRHRHDAIAPDLNVPEDLRGLDPTLPHVHATMDAAVADAEEFLLKRARDETVR
DSG
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atggcctctcacgtcggcgggtatctccgtcacatcatggacacctgtgcccagaaccgg
tcgggacaggttgccgattacatcccggaactggcggccgtcgacccggacggttacggg
ctctcgctgtgcgtgcacgacgggcacacctactcgtgcggcgacagcgaccacgagttc
accatccagtcggtctcgaaaccgctgacctatgcgatggtgctcagtcgtctcggcgcg
gtggccgcggaccccaagatcggtgtggaaccgtccggggaggcgttcaacgagatcagc
gtcgacgcccggcgccgcccacgtaacccgatgatcaacgccggcgccatcatgtcggcg
tcgttgttgctgccgccggtccgcgacgtcgccgagagcgtgatcgtttccacctttgcc
gagatcgtggatttctactcggcctgcgccggccggcggctcacgatggacgaggccgtc
tatacctccgagtcgcggacggggtcccgcaatcgcgcgatcgcctacatgctggacagc
ttcggaaccctcgacaccagcccggatgccgccctcgacctgtactaccggcagtgctcg
atccgggtgaccaccgacgatctcgcggtcatcgccgccaccatcgccaacggcggactc
aacccgcgcaccggtcggcacgtcttcaatcaggaagtggcccagcgggtgctgtcggtg
atgaccacctgcggcatgtatgacggtgccggtgactgggtgaccagtgtcgggttgccg
gccaagagcggtgtcggcggggcgatcatggcggtcctgccgggacagctcgggatcggg
gtgtactcaccgcggctcgacgagcacgggaacagtgtgcgcggtggcgagacatgccgg
catctgtcgaccgacctggggctgcacatgttcaacgtcacccgggagagccgggtgacc
atccgggcggtctacgacatcagcgacgtcccggtcggcacggagtggtccgagcaggag
cgggggttcctgcgcacgtgccgcgatcgggtgcgcgtctacgaactccagggtgatctg
accttcggcggcgcggagagcgcactgcgtcggctcgagaccgacatggacgactttgtg
gtggccatcgtcgagatctcgcggatcggggtgatcgacccggtggcccgcacaatgatc
ctcagcatgaagcgcaccctcgaggagcgggggcgccaggcgatgctcgtcgatccagac
ggcgtgatgcgcgacagcgtcgaccgtcatcgccacgacgcaatcgcgccggatctcaat
gtgccagaggaccttcgcgggctcgaccccactctgccgcacgtgcacgcgacgatggac
gccgcggtggccgacgcggaagaatttctgctcaagcgcgcccgggacgaaacggttcgc
gactcgggctag

DBGET integrated database retrieval system