KEGG   Gordonia bronchialis: Gbro_2184Help
Entry
Gbro_2184         CDS       T01102                                 

Definition
(GenBank) Alkaline phosphatase
  KO
K01113  alkaline phosphatase D [EC:3.1.3.1]
Organism
gbr  Gordonia bronchialis
Pathway
gbr00790  Folate biosynthesis
gbr01100  Metabolic pathways
gbr02020  Two-component system
Module
gbr_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:gbr00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Gbro_2184
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Gbro_2184
Enzymes [BR:gbr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     Gbro_2184
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PhoD PhoD_N Pur_ac_phosph_N TAT_signal
Motif
Other DBs
NCBI-ProteinID: ACY21432
UniProt: D0LBL8
Position
complement(2315023..2316786)
Genome map
AA seq 587 aa AA seqDB search
MSAQFFQPTDHRIGDRHRSGVSIPGHTPDAGERPGTHISSSTTRRTFLRSGMVAGGAVAL
GHVATATAAPRPSRVFAHGVASGDPLPDRVILWTRITPTDSATPGSGVGPATEVAWEVAT
DTGFAAPVAAGRHITTADADFTVKVDATGLSPDSVYHYRFRVTSGPAAGAVSPIGRTRTA
PASGADVGKVRFGVVSCANWEAGYFGAYRHLAAQPDLTAIVHLGDYLYEYEAGGYTGKTG
PVRTHRPRNEIITLRDYRIRHAQYKTDPDLARLHRAHPWICTWDDHESANDAWSGGAENH
QPDEGSWVTRKAASERAYYEWMPVRPGVDANGRHLYRRLRFGRLLELSMLDLRTYRDRQV
SSTSRAIDDPARTITGAAQMNWLTHGLVSSETRWRIVGNPVMITPVVIPPLDPRTTAALT
ELLGVPTRGVPYNPDQWDGYTADRRRLLDAVRRNNIDNVVFITGDIHSSWACDIPAEVAS
YPGSGSLATELVVTSVTSSNIDDILKVPANTLGAAVPPAIMTANHHVRWNEFDSHGYAVL
TVTPAATQMDWYFVDEKADPKTGQRHARSFRVPSGSQRVQPVSRPVD
NT seq 1764 nt NT seq  +upstreamnt  +downstreamnt
atgagcgcgcagttcttccagcccaccgatcatcgaatcggtgacagacatcgttcgggg
gtcagcattccgggacacacacccgacgccggagagcgtccggggacacacatctcgtca
tccaccacccgacggacctttctgcggtccgggatggtggccggtggcgcggtcgcgctc
ggtcacgtcgcgaccgcgaccgccgcgccgaggccgagccgtgtcttcgcacacggcgtc
gcgtccggcgacccgctccccgaccgcgtgatcctgtggactcggatcaccccgacggac
tcggcgacgccgggctcgggtgtcggcccggcgaccgaggtggcctgggaggtcgccacc
gacaccgggttcgccgcaccggtggccgccgggcgtcacatcacgaccgccgacgccgac
ttcacggtcaaggtcgacgccaccggactgtcgccggattcggtgtaccactaccgtttc
cgggtcacctcgggaccggcggcgggagcggtgtcgccgatcggacgcacccgtaccgca
cccgcgtccggtgccgacgtcggcaaggtcaggttcggggtggtgtcgtgcgccaactgg
gaagccggatacttcggcgcctaccgtcacctcgcggcacagcccgacctcaccgcgatc
gtgcacctcggcgattacctctacgagtacgaagccggcgggtacaccggcaagaccgga
ccggtacggactcaccgcccgcgcaacgagatcatcaccctgcgcgactaccggattcgg
cacgcccagtacaagaccgaccccgatctggcccggcttcatcgggcgcatccgtggatc
tgcacctgggacgatcacgaatcggcgaatgacgcatggtcgggcggcgcggagaatcat
caaccggacgaaggctcgtgggtcacccgcaaggcggcatccgaacgcgcctactacgag
tggatgccggtgcggccgggtgtcgacgccaacggccggcacctgtaccgccgcctgcgt
ttcggccggctgctggaactgtcgatgctggacctgcgcacctaccgcgaccgccaggtc
tcctcgacctcgcgcgccatcgacgacccggcccgcaccatcaccggtgcggcccagatg
aactggctcacccacggcctcgtcagctcggagacccgctggcgcatcgtcggcaacccg
gtgatgatcacgccggtggtgatcccgccgttggatccgcggaccaccgctgccctcacc
gagttgctgggcgttcccacgcggggtgtgccctacaaccccgaccagtgggacggctac
accgccgaccggcgccggctgctcgacgcggtgcgtcgcaacaacatcgacaacgtcgtg
ttcatcaccggcgacatccactcgtcctgggcgtgtgacatccccgccgaggtggcgtcc
tatcccggaagtggctcgctggcaaccgaactcgtcgtcacgtcggtcacctcgagcaac
atcgacgacatcctgaaggtgcccgcgaacactctcggcgccgctgtcccgccggcgatc
atgaccgcgaatcatcacgtgcgctggaacgagttcgactcccacgggtatgccgtactg
acggtcacccccgccgccacccagatggattggtacttcgtcgacgagaaggccgacccg
aagaccgggcagcgtcacgcgcgttcgttccgggtgccgagcggctcgcaacgcgtccaa
ccggtcagtcggccggtcgactga

DBGET integrated database retrieval system