KEGG   Gordonia bronchialis: Gbro_3625Help
Entry
Gbro_3625         CDS       T01102                                 

Definition
(GenBank) Alcohol dehydrogenase zinc-binding domain protein
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
gbr  Gordonia bronchialis
Pathway
gbr00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:gbr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    Gbro_3625
Enzymes [BR:gbr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     Gbro_3625
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     Gbro_3625
    1.1.1.-  
     Gbro_3625
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 FAD_binding_3 rRNA_methylase
Motif
Other DBs
NCBI-ProteinID: ACY22813
UniProt: D0LFB8
Position
3853283..3854359
Genome map
AA seq 358 aa AA seqDB search
MRAARYYDRGDIRIENIDEPEVAPGTVGIDVAWCGICGTDLHEYADGPIFIPPAGHPQPI
SHESAPVTMGHEMSGVVYGVGEGVDGLSVGDHVVVEPYIIRDDVDTGPDSHDYHLSPDMN
FIGLGGCGGGLAEKIVVKRRWVHRVSDSVPLDQAALIEPLSVGFHAVQRSGASAGDIALI
TGAGPIGLLTAAVCRAEGISTIISEPSSLRRRKAVDADVADHVLDPTTDDVVGRVRELTG
GRGADVGFECTSVQPALDTLFDALKPTGVLVVVSIWGHPGSVEMQKLVLKEIDMRGTIAY
VNNHPAVIDLVESGKVDLSPFITGRIGLDHLIDEGFETLIHRNETAVKILVSPSGAGL
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgcggcacgctattacgaccgtggggacattcgcatcgagaacatcgatgaaccc
gaggtggcgcccggaaccgtcggcatcgacgtcgcgtggtgcggcatttgtggcaccgac
ctgcacgagtacgctgacggcccgattttcatcccgcccgcggggcatccccagccgatc
agtcacgagagcgcaccggtcaccatgggacacgagatgtcgggggtggtctatggcgtc
ggcgagggtgtcgacggtctctccgtcggtgatcacgtggtggtggagccctacatcatc
cgcgacgacgtcgacaccggcccggacagtcacgactaccatctgtcgccggacatgaac
ttcatcgggctcggcggctgcggcggcggactcgccgagaagatcgtcgtcaaaaggcgt
tgggtacaccgggtttccgattctgtgccgcttgatcaggccgccctcatcgaaccgttg
tcggtgggattccacgccgtgcaacgcagcggtgcgagtgccggcgacatcgcactcatc
accggggcgggacccatcgggttgctcaccgcggccgtatgccgggccgaggggatcagc
accatcatcagcgaaccgagttcgttgcggcggcgcaaggccgtcgacgccgacgttgcc
gaccacgtcctcgatcccaccaccgacgacgtcgtcggccgggtccgggaactcaccggt
ggccgcggtgccgacgtgggcttcgaatgcacgtcggtgcagcccgcgctggacacgctc
ttcgacgcgctgaagccgacaggtgtgctcgtggtggtgtcgatctggggacatcccggc
agcgtggagatgcagaagctcgtgctcaaggagatcgacatgcgcggaaccatcgcgtac
gtcaacaatcatcccgcggtcatcgaccttgtcgagagcggcaaggtggacctgtcgccg
ttcatcaccggccgtatcggactcgaccacctcatcgacgagggctttgaaaccctcatc
caccgcaacgagaccgcggtgaagatcctggtgtcaccgtccggcgccggtctctga

DBGET integrated database retrieval system