KEGG   Gordonia bronchialis: Gbro_4648Help
Entry
Gbro_4648         CDS       T01102                                 

Definition
(GenBank) Pyridoxal-5'-phosphate-dependent protein beta subunit
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
gbr  Gordonia bronchialis
Pathway
gbr00260  Glycine, serine and threonine metabolism
gbr00750  Vitamin B6 metabolism
gbr01100  Metabolic pathways
gbr01110  Biosynthesis of secondary metabolites
gbr01120  Microbial metabolism in diverse environments
gbr01230  Biosynthesis of amino acids
Module
gbr_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:gbr00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Gbro_4648
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Gbro_4648
Enzymes [BR:gbr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Gbro_4648
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: ACY23774
UniProt: D0L7I5
Position
4979585..4980715
Genome map
AA seq 376 aa AA seqDB search
MDGEPYLYERSGRRYPIDDWRWRGDDGSPLSVSAMTGPTPDPIDSAERSLWRYRAALPVD
AEHRISLGEGCTPMPALDWRGHRVRFKLEWFNPTGSFKDRGVSVMISHLQSQGVTRVLED
SSGNGGSAVAGYAAAAGMDAKILVPAATSPAKILQARAYGAEIELVGGTRDDVGDEAIRQ
SAFIPYASHNWHPMFIQGTKTIGYEIWEDLGFRVPDNIVLVAGAGSVALGCDLAATELLA
TGAIDRRPRLFVGQPADWATIAELVNGVTGPDDAQRRPTIAEGASIARPVRLPEVAAAIT
RSDGGAVAVSEDSIHAAVRALAGRGLYAEPTSAVAAAALDHFIDTGDIRSDQITVVVLTG
SGLKSPARMGEVVGVS
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
gtggacggtgagccttatctgtacgagcgcagcggacgccggtacccgatcgacgactgg
cgctggcgcggcgatgacggatcgccgctgtcggtgagcgcgatgaccgggccgacgccg
gatccgatcgattcagccgagcggtcgctgtggcggtaccgcgcggctcttcccgtcgac
gccgagcaccgaatcagtctcggcgagggttgcacaccgatgccggcactcgactggcgt
gggcatcgggtgcgcttcaagctcgaatggttcaatcccaccggcagtttcaaggatcgc
ggggtgtcggtgatgatctcgcatctgcagtcccagggtgtcacccgggtgctggaggat
tcgtcgggcaatggcggcagcgccgtcgccggttatgcggccgccgccgggatggacgcg
aagatcctggtgccggcggcgacgtcacccgccaagatcctgcaggcgcgtgcctacggc
gcggagatcgagctcgtcggaggtacccgcgacgacgtcggcgacgaggccatccggcag
tccgcgttcattccgtatgcgagtcacaactggcatccgatgttcatccagggcaccaag
accatcgggtacgagatctgggaggatctcggcttccgcgtacccgacaacatcgttctg
gtcgccggggccggcagcgtcgcgctcggttgcgatctggcggcgaccgaactgctggct
accggggcgatcgatcgtcggccgcgactgttcgtcggacagccggcggattgggccacc
atcgccgagttggtcaacggcgtcaccggccccgacgatgcgcaacgtcgacccaccatc
gccgaaggcgcttcgatagcccggccggtgcgtctgccagaggtggccgcggcgatcacc
cggtccgacggtggggccgtggccgtatcggaggacagcatccacgcggcggtccgggcg
ctcgccggacgtgggctctacgccgaaccgaccagcgctgttgccgccgccgcactcgac
cacttcatcgacaccggcgacatccgatccgaccagatcaccgtcgtcgtgctcaccggg
agcggcctgaaatcgccggcgcggatgggcgaggttgtcggggtgtcctga

DBGET integrated database retrieval system