KEGG   Granulibacter bethesdensis CGDNIH4: GbCGDNIH4_0088Help
Entry
GbCGDNIH4_0088    CDS       T03156                                 

Definition
(GenBank) ApaG protein
  KO
K06195  ApaG protein
Organism
gbs  Granulibacter bethesdensis CGDNIH4
Brite
KEGG Orthology (KO) [BR:gbs00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    GbCGDNIH4_0088
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525
Motif
Other DBs
NCBI-ProteinID: AHJ64450
Position
complement(97302..97811)
Genome map
AA seq 169 aa AA seqDB search
MCDPNPAWRHCDQGRGPSFYRHVCQHHTIDDPLMSDDNTYVWVTRHIRVTVQPIYLADQS
RPDGHHFVWAYRVCIANEGSSTVQLLQRTWHITNALGHTQHIHGDGVVGEQPVLEPGEEF
NYTSGTPLDTPSGFMHGTYHMIETSSGEAFDITIPAFSLDSPHQDTKLH
NT seq 510 nt NT seq  +upstreamnt  +downstreamnt
ttgtgcgaccccaatccggcctggcgccattgcgatcaggggcgaggcccctcattctat
aggcatgtctgtcagcaccacacgattgatgatcctctcatgagcgatgataacacgtat
gtctgggtgacccggcacatccgcgtgaccgtccagccaatctatctggccgatcagtcc
cgccccgatggtcaccatttcgtatgggcctatcgggtctgtatcgccaatgaaggttct
tccacggttcagttgctccaacgtacctggcacatcaccaatgcgctgggccatactcaa
catattcacggtgacggcgtggtaggggagcagcctgtgctggaacctggcgaagaattc
aattacacgtccggcacaccgctcgatacgccctccggctttatgcacggaacatatcat
atgatcgaaacgtcctccggggaggccttcgatatcaccattccggccttcagcctcgac
agcccccatcaggacacaaagctgcattga

DBGET integrated database retrieval system