KEGG   Granulibacter bethesdensis CGDNIH4: GbCGDNIH4_0113Help
Entry
GbCGDNIH4_0113    CDS       T03156                                 

Definition
(GenBank) Hydrolase (HAD superfamily)
  KO
K20866  glucose-1-phosphatase [EC:3.1.3.10]
Organism
gbs  Granulibacter bethesdensis CGDNIH4
Pathway
gbs00010  Glycolysis / Gluconeogenesis
gbs01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:gbs00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GbCGDNIH4_0113
Enzymes [BR:gbs01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.10  glucose-1-phosphatase
     GbCGDNIH4_0113
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hydrolase HAD_2 Hydrolase_like DUF2608
Motif
Other DBs
NCBI-ProteinID: AHJ64482
Position
125573..126202
Genome map
AA seq 209 aa AA seqDB search
MIDLVLFDMDGVLAEVDKSARATWLGALAGCRAEDVQQALWDSGFDDQGDDGRLRGEAYL
TAFGQVLGYPLSVQEWAEARRIATRPKPEVLSLVARLHPRIGRAVLTNNADILPGCMAMI
CPPVATLFGGRIYASGAFGSAKPDPAVFLACLKQIGVRPEHTLFIDDRALHVEGARQAAC
HGLLFTSAEALEAELNRYGLLRPVAEMSA
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
atgatcgatctggttctgttcgatatggatggggtgctggcggaggtcgataaatcggct
cgtgccacatggctcggtgcgctggccggatgccgggcggaggatgtgcaacaggctctg
tgggactcaggctttgatgatcagggcgatgatggccgtctgcgtggggaagcctatctg
acggcattcgggcaggtgctgggctatccgctctctgtgcaggaatgggcggaagcccgt
cgcattgccacccggccgaaaccggaggtgctgtcgctggtggcgcggctccatccccgg
attggacgcgccgtgctgaccaacaatgcggatattttgcccggctgcatggcgatgatc
tgtccgccggtcgcaaccctgttcggcggtcggatttatgccagcggcgcgttcgggagc
gccaagcccgatccggcagtgttccttgcctgcctgaagcagataggtgtcaggcctgag
catactctgttcatcgatgatcgggcgctgcatgtggagggtgcccgtcaggccgcatgc
catgggctgctgtttacctcggcggaggctctggaggcggagttgaaccggtatggtctg
ctccgtccggtggctgagatgtcagcgtaa

DBGET integrated database retrieval system