KEGG   Granulibacter bethesdensis CGDNIH4: GbCGDNIH4_2157Help
Entry
GbCGDNIH4_2157    CDS       T03156                                 

Definition
(GenBank) L-fuculose phosphate aldolase
  KO
K01628  L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
gbs  Granulibacter bethesdensis CGDNIH4
Pathway
gbs00051  Fructose and mannose metabolism
gbs01100  Metabolic pathways
gbs01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:gbs00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    GbCGDNIH4_2157
Enzymes [BR:gbs01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     GbCGDNIH4_2157
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldolase_II
Motif
Other DBs
NCBI-ProteinID: AHJ65359
Position
complement(2425807..2426487)
Genome map
AA seq 226 aa AA seqDB search
MAGACGMDEESSARRALVEACRTMTSLGINQGTAGNISLRWGNRMLISPSAIPYDEMTPD
MVASMPLDDDSGGWEGPCKPSTEWRFHHGILCSRPEVGAVLHAHPVFCTALAMARRSIPP
CHYMITCFGGDDIRCAPYATFGTAELADLALSALEGRKACLLANHGMVVCGTDLRQALWL
GVELETLARQYWHSLQIGGPVLLSPRELAETRARFQGYGLQEKQKP
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
gtggcaggagcatgcggaatggatgaggaatcctcagcccggcgcgcgctggtggaggcg
tgccgaaccatgacgtctctgggaatcaatcagggaacggccgggaatatcagcctgcgt
tggggaaaccggatgctgatttctccctccgcgattccttatgacgaaatgacgcccgat
atggtcgcttccatgccgctggatgatgacagtggcgggtgggagggcccctgcaagcca
tcgacagaatggcgtttccatcatggcatcctgtgctcacggccggaagtcggggccgtc
ctgcatgcgcatccggtgttctgcaccgcgctggctatggcgcgacggtctattccaccc
tgtcattatatgatcacatgcttcggcggagacgatatacggtgtgctccctatgccacg
ttcggcacggcagaattggctgatctggccctatccgcactggaggggcgcaaggcctgc
ctgctggccaatcatggcatggtggtctgtggcactgatctgcgtcaggcattgtggctg
ggggtggaactggaaacgctggccaggcaatactggcacagccttcagattgggggaccg
gttctgctttctccgcgagaactggcagaaacccgcgctcgtttccaagggtacgggctt
caggaaaaacagaagccctaa

DBGET integrated database retrieval system