KEGG   Gallionella capsiferriformans: Galf_0297Help
Entry
Galf_0297         CDS       T01295                                 

Definition
(GenBank) Aldose 1-epimerase
  KO
K01792  glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
gca  Gallionella capsiferriformans
Pathway
gca00010  Glycolysis / Gluconeogenesis
gca01100  Metabolic pathways
gca01110  Biosynthesis of secondary metabolites
gca01120  Microbial metabolism in diverse environments
gca01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:gca00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Galf_0297
Enzymes [BR:gca01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     Galf_0297
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-ProteinID: ADL54342
UniProt: D9SJ66
Position
344554..345459
Genome map
AA seq 301 aa AA seqDB search
MTTALNSQFGIKGQLVFNVDASGLIVAEIDNALGRASLCLQGAHLMSWQPKSQAVPVVWL
SRDTKPAVGKSIRGGAPVCWPWFGAHASEAGFPGHGFARTVPWRVIESGSEPDGATRLTL
RLVPSDKTRAQWLHECNVDLTVIVGETLRMEMTTENTGATNFVIGEALHTYFQISDIGAI
RVTGLEGTEYWDKVGGSNLRRQDGAITFNSEVDRVYINTGSECVIHDDKLARRIHIAKSG
SQSTVVWTPWVEKANKMGDMGQPDGWREMVCVESVNAIENVVTVAAGTRHTMIVEYRAES
V
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atgacgacagcattgaattcgcaattcggtatcaaagggcaattggtttttaacgtagac
gcgagcggtttgatcgtcgctgaaatcgacaacgcattgggccgcgcatcgttgtgcttg
cagggcgcacatctgatgagctggcagccgaaaagtcaggcggttcccgtggtgtggttg
tcgcgcgacacgaaacccgcagtcggtaaatcgatacgcggcggtgcgccggtgtgctgg
ccctggtttggcgcgcatgcgagcgaagcaggctttccgggtcacggttttgcacgcact
gtgccttggcgcgtgatcgagtcgggcagcgaacccgatggcgcgacgcgactgaccttg
cgtcttgtgccctccgacaaaacgcgcgcacagtggttgcatgaatgcaacgtggatctg
acggtgattgttggtgaaacgctgcgtatggaaatgacgactgaaaataccggtgccaca
aatttcgtgatcggcgaagcgctgcacacctattttcagatcagcgacatcggcgctatc
cgcgtgacggggctggaaggcactgaatactgggacaaggtgggcggctccaacttgcgt
cgtcaggatggtgcgatcacgtttaatagtgaagttgatcgcgtctatatcaacaccggc
agcgagtgtgtgattcacgacgataagctggctcgtcgcattcatatcgctaaatcaggc
agccaatcgaccgtggtgtggacgccgtgggtcgaaaaagctaataaaatgggcgatatg
gggcagccggacggctggcgcgagatggtttgcgtcgaatcggtcaatgcgattgaaaat
gtggtgacggtcgcggcaggcacgcgtcacaccatgatcgttgaatatcgtgccgagtcg
gtttaa

DBGET integrated database retrieval system