KEGG   Gallionella capsiferriformans: Galf_1572Help
Entry
Galf_1572         CDS       T01295                                 

Definition
(GenBank) phosphofructokinase
  KO
K21071  ATP-dependent phosphofructokinase / diphosphate-dependent phosphofructokinase [EC:2.7.1.11 2.7.1.90]
Organism
gca  Gallionella capsiferriformans
Pathway
gca00010  Glycolysis / Gluconeogenesis
gca00030  Pentose phosphate pathway
gca00051  Fructose and mannose metabolism
gca00052  Galactose metabolism
gca00680  Methane metabolism
gca01100  Metabolic pathways
gca01110  Biosynthesis of secondary metabolites
gca01120  Microbial metabolism in diverse environments
gca01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:gca00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Galf_1572
   00030 Pentose phosphate pathway
    Galf_1572
   00051 Fructose and mannose metabolism
    Galf_1572
   00052 Galactose metabolism
    Galf_1572
  Energy metabolism
   00680 Methane metabolism
    Galf_1572
Enzymes [BR:gca01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Galf_1572
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     Galf_1572
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-ProteinID: ADL55590
UniProt: D9SGE3
Position
complement(1714513..1715661)
Genome map
AA seq 382 aa AA seqDB search
MATQHQLRVQVVAKYIGILTAGGDSPGLNAAIRGVGKAALNHYGMQMIGFRDGFRGLMEN
RTMRLEAADLSDILTRGGTLLGTSRDKPHRMPIGGKQMDMTDVIVGNYYDNHLDVLVCLG
GGGTQKNALRLKERGLNVITLPKTIDNDIAMTDITFGFDTALGIATDAIDRLHSTAHSHH
RIIVVEIMGHRAGWLALGAGIAGGADVILIPEVPYAVESVAEAIRERSRRGKSFSIVAIA
EGALSLQEHATLAEVVKKRNASKHKEGKKAVVESAPELQYAEKTVRLAKQLELLTGLESR
ITILGHLQRGGIPSAADRLLSTRLGTACADLIDQGQFGVMVAARGDATQAVLLEEVAGKV
KTVPQDHPWIQSARHLGISMGD
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atggcgactcaacatcaattaagagtgcaagtcgtggcaaaatatattggaattttaacg
gctggtggcgacagtcccggtctgaacgccgcaatccgcggtgttggcaaggccgcgctt
aatcattacggtatgcaaatgattggttttcgcgatggctttcgcggactgatggaaaac
cgcacaatgcggctcgaagctgctgatctgtctgatattctgacacggggtggtacgttg
ctcggcaccagtcgtgataagccccaccgcatgccaatcggtggaaaacagatggatatg
accgatgtgatcgttggaaattactacgacaaccatctggatgtgctggtttgtctgggc
ggtggcggcacacagaaaaatgccttgcgtctgaaagagcgcggtctgaacgtgattacc
ctgcccaagaccatagacaacgatatcgcgatgaccgatatcacctttggttttgacacg
gccttgggtattgccaccgatgcgattgatcgcctgcacagtacggcgcacagccatcac
cgcatcatcgtggtggaaatcatggggcatcgtgccggctggctcgcgctgggtgccggt
attgccggcggtgctgatgtgatcctgattccggaagtcccttatgctgtggaaagcgtg
gccgaagcgattcgtgagcgcagccgtcggggaaaaagctttagtatcgtcgcgattgct
gaaggtgcgctgtctttgcaggaacatgcgacgctggcagaggttgtgaaaaagagaaat
gccagcaaacataaagagggcaaaaaagccgtcgtcgagtctgcgccagaactgcagtac
gcggagaaaacggtgcgtctggccaagcaactcgaattactgaccggactcgagtcaagg
attaccatcctggggcacttgcagcgtggcggtattccttctgctgcagatcggttgttg
tcgacgcgactcggaactgcctgtgccgatctgattgatcagggacaattcggcgtgatg
gtggcggcaaggggcgatgcgacgcaagctgtgctgctggaggaggtggccggaaaagtt
aaaacagtgccgcaagatcacccctggatacagagcgcccgtcatttaggtatcagcatg
ggagattga

DBGET integrated database retrieval system