KEGG   Gallionella capsiferriformans: Galf_2146Help
Entry
Galf_2146         CDS       T01295                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
gca  Gallionella capsiferriformans
Pathway
gca00010  Glycolysis / Gluconeogenesis
gca00051  Fructose and mannose metabolism
gca00562  Inositol phosphate metabolism
gca01100  Metabolic pathways
gca01110  Biosynthesis of secondary metabolites
gca01120  Microbial metabolism in diverse environments
gca01130  Biosynthesis of antibiotics
gca01200  Carbon metabolism
gca01230  Biosynthesis of amino acids
Module
gca_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:gca00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Galf_2146
   00051 Fructose and mannose metabolism
    Galf_2146
   00562 Inositol phosphate metabolism
    Galf_2146
Enzymes [BR:gca01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Galf_2146
Exosome [BR:gca04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Galf_2146
  Exosomal proteins of bladder cancer cells
   Galf_2146
  Exosomal proteins of melanoma cells
   Galf_2146
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: ADL56151
UniProt: D9SII8
Position
complement(2325847..2326599)
Genome map
AA seq 250 aa AA seqDB search
MRRKLVVGNWKMYGRLARNQALLQGVLDGVRELRAADYAVCVPYPYLSQAATMLAGSNVA
WGAQNLSPQEEGAFTGAVAPGMLVDFGCSYVIIGHSERRGLFHESNEIAAAKFEAAQKAG
MKPIFCVGETLAERESGITEQVVATQLDAVLVRFGAKALSNAVIAYEPVWAIGTGKTASP
DQAQAVHAFIRQRVAAHDAAVAQGLCILYGGSVKASNAVELFGMPDIDGGLIGGASLVAD
DFVAICRAAQ
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgcgtcgcaaactagtcgttggaaactggaaaatgtacggccgcttggcgcgtaatcaa
gcattgctgcaaggggttctggacggcgttcgtgaattgcgcgctgcagactatgcggta
tgtgttccgtatccctatctgtctcaggcggcaacgatgttggcaggtagtaatgtggct
tggggggcgcagaatttgagtccacaggaagaaggcgcgttcacgggtgcggtagcgccc
ggcatgctggttgattttggttgcagttatgtgattatcggtcactccgaacgtcgcggt
ctgttccatgaaagcaatgaaatcgctgctgcgaagtttgaggcagctcaaaaggccggt
atgaagccgatcttctgtgtgggcgaaacgctagctgaacgtgagtccggaattacagaa
caagtcgttgcaacgcaactggatgccgtgctggtgcgttttggcgcgaaggcactgtcc
aatgcggtgattgcatacgaacctgtgtgggcaatcggtaccggcaagacggcaagtcca
gatcaggcgcaggcagtgcacgcgttcattcgtcaacgtgtagcggcgcatgatgcagcg
gttgcgcaaggtttatgtattctttacggcggcagtgtgaaggcatccaatgcggtcgaa
ttgttcggtatgccggacatcgatggcggtctgattggtggcgcttcgctggttgctgat
gattttgtggcgatatgtcgcgcagcgcaataa

DBGET integrated database retrieval system