KEGG   Gallionella capsiferriformans: Galf_2208Help
Entry
Galf_2208         CDS       T01295                                 

Definition
(GenBank) acetate/CoA ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
gca  Gallionella capsiferriformans
Pathway
gca00010  Glycolysis / Gluconeogenesis
gca00620  Pyruvate metabolism
gca00640  Propanoate metabolism
gca00680  Methane metabolism
gca01100  Metabolic pathways
gca01110  Biosynthesis of secondary metabolites
gca01120  Microbial metabolism in diverse environments
gca01130  Biosynthesis of antibiotics
gca01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:gca00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Galf_2208
   00620 Pyruvate metabolism
    Galf_2208
   00640 Propanoate metabolism
    Galf_2208
  Energy metabolism
   00680 Methane metabolism
    Galf_2208
Enzymes [BR:gca01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Galf_2208
Lipid biosynthesis proteins [BR:gca01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Galf_2208
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: ADL56212
UniProt: D9SIP9
Position
2384198..2386165
Genome map
AA seq 655 aa AA seqDB search
MSDIQSVMHENRVFTPSADFVKQANVSGMEAYQALCAEASKDYTGFWGRLARETLQWKKP
FTKTLDDSNAPFYKWFEDGELNVSYNCLDAHLAASADKTAIIFEADDGVVTKINYRDLHA
RVCQFANGLKSRGIKKGDRVVIYMPMSIEAVVAMQGCARIGAIHSVVFGGFSSKSLHERI
TDAKASAVITADAQMRGGRTMPLKPAVDEALTLGGCESVHTVIVYQRAACDTAWDASNNI
WWHDLVAGQESVCEPEWVGAEHPLFILYTSGSTGSPKGVQHSSAGYLLGAMISMQWVFDY
KASDIFWCTADVGWITGHSYVAYGPLAMGGTQVIFEGVPTYPDAGRFWKMIQDHKVTTFY
TAPTAIRSLIKLGGELPKQYDLSSLRLLGSVGEPINPEAWMWYYNTVGGARCPIVDTWWQ
TETGCHMIAPLPGAMPIKPGTCTLPLPGIMATIVNEAGDEVFDQHGGFLVIKKPFPSQIR
TIWGDPERYKKGYFPEEMHGAYLAGDSAHRDEDGYFWIMGRIDDVLNVSGHRLGTMEIES
ALASNPLVAEAAIVGRPHEIKGEAVVAFVVLKGARPETPEKAREIAEILRNWVAKEIGPI
AKPDEIRFGENLPKTRSGKIMRRLLRAIAKGEEITQDVSTLENPAILDQLKNAVR
NT seq 1968 nt NT seq  +upstreamnt  +downstreamnt
atgtccgacattcagtctgtaatgcacgaaaaccgtgtctttaccccctcagcagatttc
gtcaaacaggccaatgtttccggcatggaggcctatcaggcgctatgcgccgaagcatca
aaggactatacgggcttttggggacgtctggcgcgtgaaacgctgcaatggaaaaaaccg
tttaccaagacgctagacgacagcaatgcgcccttctataagtggtttgaggacggcgaa
ctgaacgtgtcctacaactgtctggatgcgcatctggctgccagcgccgacaagaccgca
atcatcttcgaagcagatgacggcgttgtgacaaaaatcaattaccgcgacctgcatgca
cgcgtgtgccagttcgccaacggcttaaaatcgcgcggcatcaaaaagggcgatcgcgtc
gtcatctatatgccgatgagcattgaagccgtggtcgcgatgcaaggctgtgcgcgcatc
ggcgccattcactccgtcgtattcggcggtttctcgtccaaaagtctgcacgaacgcatc
accgatgccaaagcctctgccgtcattaccgccgatgcacaaatgcgcggcggccgcacc
atgccgcttaaacccgccgtcgatgaagccctgacgctgggcggatgcgaatcggtacac
accgtcatcgtctaccagcgcgcagcctgcgataccgcatgggatgcgtccaacaacatc
tggtggcacgatctggtcgccggacaagaaagcgtttgcgagcctgaatgggtcggcgca
gaacatccgctgttcattctttacacctcaggatcaaccggctccccgaaaggcgtgcag
cattcaagcgccggttatttgctgggcgcgatgatctcgatgcaatgggtgttcgactat
aaggcttccgatattttctggtgtaccgccgatgtgggctggatcaccggccacagttat
gtcgcctacggcccgttggcgatgggcggcacgcaagtcattttcgaaggcgtccccact
tacccggatgcagggcgtttctggaaaatgattcaggatcacaaagtcacgaccttctac
accgcaccgacggcgatccgttcgctgatcaaactgggcggcgagctgccaaaacaatac
gatctgtccagcctgcgcctgttaggctctgtgggtgagccgatcaatcccgaagcctgg
atgtggtattacaacaccgtaggcggcgcacgctgccctatcgtggacacctggtggcag
actgaaaccggctgtcacatgatcgccccgctgccgggtgcaatgccgatcaagccgggc
acctgtaccctgccgctgccgggcattatggcgaccatcgtcaacgaagcgggcgacgaa
gtgttcgatcagcacggcggatttctggtcatcaaaaaaccgttcccgtcgcaaatccgc
accatctggggcgaccctgaacgttacaaaaagggctatttcccggaagaaatgcacggc
gcgtatctggccggcgactctgcacaccgcgatgaagacggctatttctggatcatgggc
cgtatcgacgacgtactgaatgtctcaggccaccgtctgggcactatggagatcgaatct
gcgctggcctccaacccgctggttgcggaagcggccatcgtcggacgcccgcatgaaatc
aagggtgaagcggtcgtcgctttcgtcgttttaaaaggcgcacgccccgagacaccggaa
aaagcacgcgaaatcgccgagatactgcgcaactgggttgccaaggaaatcggcccgatc
gccaagcctgacgaaatccgcttcggtgagaatctgcccaagacgcgctcgggcaagatc
atgcgtcgcctgctgcgcgccatcgctaagggcgaagaaatcacgcaagacgtatcgacg
ctggaaaacccggctattctcgatcaacttaagaatgccgtcagatag

DBGET integrated database retrieval system