KEGG   Gallionella capsiferriformans: Galf_2378Help
Entry
Galf_2378         CDS       T01295                                 

Definition
(GenBank) methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
gca  Gallionella capsiferriformans
Pathway
gca00450  Selenocompound metabolism
gca00970  Aminoacyl-tRNA biosynthesis
gca01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gca00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    Galf_2378
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Galf_2378
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:gca01007]
    Galf_2378
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:gca03016]
    Galf_2378
Enzymes [BR:gca01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     Galf_2378
Amino acid related enzymes [BR:gca01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   Galf_2378
Transfer RNA biogenesis [BR:gca03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    Galf_2378
 Prokaryotic type
   Other AARSs
    Galf_2378
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA_bind tRNA-synt_1 tRNA-synt_1e tRNA-synt_1f Anticodon_1
Motif
Other DBs
NCBI-ProteinID: ADL56380
UniProt: D9SJJ2
Position
2562215..2564302
Genome map
AA seq 695 aa AA seqDB search
MTPRKILVTSALPYANGSIHLGHLVEYIQTDIWVRFQKMQGHEVHYVCADDTHGTPIMLR
AESEGITPEALIARVWQEHYDDFAAFHVEFDHYGSTNSAENKVCAESIYLALREKGLIEV
RSIEQFYDPVKNMFLPDRFIKGECPKCHAKDQYGDNCEVCGAAYAPIELINPYSAVSGAA
PVMRNSDHYFFKLSADTCQQFLREWTRSGSLQSEAANKMQEWLGAEGENKLSDWDISRDA
PYFGFEIPDAPGKYFYVWLDAPVGYMGSFRQLCNSRMQDSGSRIEFDEYWKPDSTTELYH
FIGKDILYFHALFWPAMLEHAGFRTPTKLFAHGFLTVNGEKMSKSRGTFITAKSYVDNIK
NTEYLRYYYAAKINGSMEDLDLNLDDFVAKVNSDLIGKYINIASRCAGFIAKKFDGKLGA
TDLAASAEFQTAYASGEIAKSFEARDFARALREIMRLADVANQYIAEQKPWELAKQEGAE
AQLHIACSTAMTLFRDLTLYLKPVLPVLAGQVEAFLNIAPLMWTGVWQALPNGHGINTYQ
HLATRLDPKLIEAMNAANMESLKPVTESHSETRHAEAQQHAITPIAETISIEDFSKIDLR
VAMIVNAEHVEGAEKLLKLTLDIGEAAPRTVFAGIKSAYDPAALKGRMTVMVANLAPRKM
KFGMSEGMVLAASGSTPGLFVLSPDAGATPGMRIK
NT seq 2088 nt NT seq  +upstreamnt  +downstreamnt
atgactcctcgtaaaatcctcgttacctccgccctgccctatgctaacggcagcatccac
ttaggacatctggtcgaatatatccagaccgacatctgggtacgcttccagaagatgcag
ggccacgaggtgcattacgtgtgcgccgacgacacccacggcacgccgatcatgctgcgc
gccgagagcgaaggcatcacacccgaagcgctcatcgcgcgcgtctggcaggaacattac
gatgatttcgcggcgtttcacgtcgaattcgatcactacggttcaaccaattcagccgaa
aacaaggtctgcgccgaatccatctacctcgccttgagggaaaaaggactgatcgaagtg
cgctcgatcgaacagttctacgatccggtgaaaaacatgttcctgccggatcgtttcatc
aaaggcgaatgcccgaagtgtcacgccaaggatcagtatggcgacaactgcgaggtatgc
ggcgcggcctatgcaccgatcgaactgatcaacccgtattcggccgtatcgggcgcagcg
cctgtgatgcgcaactcggatcactatttcttcaaactgtctgccgacacctgccagcaa
tttttgcgcgaatggacgcgtagcggttcgctgcaatcggaagcggccaacaagatgcag
gaatggctgggcgcggaaggggaaaacaagctctccgactgggatatctcgcgcgatgcg
ccgtatttcggcttcgaaattccggatgcgccgggcaagtatttctacgtctggctggat
gcgccggtcggctacatgggcagcttcaggcaactgtgcaacagcaggatgcaggattca
gggtcgaggattgagtttgatgaatactggaagccggattccaccaccgagctgtatcac
ttcatcggcaaagatattttgtatttccatgcgctgttctggcccgccatgcttgagcac
gcaggtttcagaacgccgaccaagctgttcgcgcacgggttcttgaccgtcaacggcgag
aagatgagcaaatcgcgcggcaccttcatcaccgcgaagagctatgtggacaacatcaaa
aacaccgaatatctgcgctattactacgccgccaagatcaacggctcgatggaagatctg
gatctgaatctggatgatttcgtcgccaaggtgaattcggacctgatcggcaaatacatc
aacatcgccagccgttgcgcgggcttcatcgccaaaaaattcgacggtaaacttggggca
accgaccttgccgccagcgcagaattccaaaccgcttatgccagcggtgagatcgcgaag
agttttgaggcccgtgatttcgcacgtgccttacgcgagatcatgcgtctggcggatgtc
gcaaatcagtacatcgccgaacaaaagccgtgggagctggcaaagcaggaaggcgctgaa
gcgcaactgcatatcgcctgctccaccgcgatgacgctgttccgcgacctgacgctgtat
ttaaaacccgtattgcctgtgctggcaggtcaggtcgaagctttcctcaatatcgccccc
ctgatgtggacgggagtatggcaggcgctgcccaacggacacggcatcaatacttatcag
catctggccacccgtctcgatcctaagttgatcgaagcaatgaacgccgctaatatggaa
agcttaaaacctgtgactgaatctcactcagaaacgcgccatgccgaagcgcagcaacac
gccattaccccaatcgccgagacgatttccatcgaagatttctctaagatagacctgcgc
gtggcgatgatcgtcaatgccgaacacgtggaaggcgcggaaaagctgctgaaactgaca
ctggatatcggcgaggctgcgccgcgcacggtatttgccggcatcaaatccgcttatgat
ccggcagcgctcaaggggcgtatgacggtcatggtcgctaatctcgccccgcgcaaaatg
aagttcggcatgagcgaaggcatggtgctggccgcctccggcagcacgccaggattgttc
gtcctgtcaccagatgcgggcgcgacaccgggtatgcgcatcaaataa

DBGET integrated database retrieval system