KEGG   Gallionella capsiferriformans: Galf_2510Help
Entry
Galf_2510         CDS       T01295                                 

Definition
(GenBank) Uroporphyrinogen III synthase HEM4
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
gca  Gallionella capsiferriformans
Pathway
gca00860  Porphyrin and chlorophyll metabolism
gca01100  Metabolic pathways
gca01110  Biosynthesis of secondary metabolites
gca01120  Microbial metabolism in diverse environments
Module
gca_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:gca00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Galf_2510
Enzymes [BR:gca01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     Galf_2510
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4
Motif
Other DBs
NCBI-ProteinID: ADL56509
UniProt: D9SK97
Position
complement(2702130..2702876)
Genome map
AA seq 248 aa AA seqDB search
MAKGELAGLKVLVTRPRDQAFTLAQAIGQQGGTAVLFPMLEIAPVPDLLRLQEQVSHVEQ
ANLAIFISPNAVKYGMAATGGKVPARVATVGEGSAKALRALGIAHVIVPVERFDSEGLLA
RPELQNIDGWHVMIFRGDGGRELLGDTLRERGARVEYVTCYLRCKPQCPVSELAGVDLIT
VTSSEALNHLSQMIVDSKEVFDRPLFVIHPRIAELAKRLGWSKVHLTESGDDGLLAGLQA
WAKSGVQA
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atggctaagggtgagctggccggtttgaaagtgctggtgacgcgtccgcgtgatcaggct
tttacgctggctcaggcgatcggacagcagggcggcaccgccgtgctgttcccgatgctg
gagatcgcgcccgtgccggacctgctgcgattacaagaacaagtgtcgcatgttgaacag
gcgaatcttgcaattttcatcagcccgaatgccgtgaaatatggcatggcggccaccggg
ggcaaagtgccggctcgtgttgcgacggtgggtgaggggagcgcgaaagcgctgcgagcg
ctaggcattgcgcatgtgatcgtgcctgtcgagcgattcgatagtgaaggtttgttagca
cggcctgaattacaaaacatcgacggctggcatgtgatgatttttcgcggtgacggcggt
cgcgagttactgggagatactttgcgcgagaggggcgcacgcgtggaatatgtgacctgt
tatctgcgctgcaagccgcaatgtccggtgagcgagctggccggtgtcgatttgattacc
gtgaccagcagcgaggcgctgaaccatttgtctcagatgatcgttgattcaaaggaggtt
tttgacaggccgctgtttgtcatacacccgcgtatcgccgaattggcgaagcgcttggga
tggtcgaaggttcatctgacggagtcgggggatgacggtttgctggcagggctgcaggca
tgggcaaaatccggggttcaggcgtaa

DBGET integrated database retrieval system