KEGG   Gallionella capsiferriformans: Galf_2591Help
Entry
Galf_2591         CDS       T01295                                 

Definition
(GenBank) Holliday junction DNA helicase RuvA
  KO
K03550  holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
gca  Gallionella capsiferriformans
Pathway
gca03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:gca00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Galf_2591
Enzymes [BR:gca01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     Galf_2591
DNA repair and recombination proteins [BR:gca03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     Galf_2591
    RecFOR pathway proteins
     Galf_2591
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuvA_N HHH_5 RuvA_C HHH HHH_8 DNA_pol_lambd_f IMS_HHH Transposase_20 Cdd1 5_3_exonuc
Motif
Other DBs
NCBI-ProteinID: ADL56588
UniProt: D9SCK7
Position
complement(2788855..2789436)
Genome map
AA seq 193 aa AA seqDB search
MIGRLSGILLEKTPPQILLDVQGVGYELEVPMSTFYNLPPLHEKVVLHTQLIVREDAHLL
YGFGSTDERIAFRQLLKISGVGPKLALSVLSGLSLNDLADAVANKEAGRLTKIPGVGKKT
AERLLLELEGKFTVMGVAMAHGVPVTSASGDIVNALQALGYNDKEAALAAKQLPKDVSVS
DGIRQALKFLSRA
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
gtgatcggtcgattgtcgggtattttgctggaaaaaacgccgccgcagattttgctggat
gtgcaaggggtggggtatgagctagaggtgccgatgagcaccttttataatttgccaccg
ctgcatgaaaaagtcgtgctgcacacgcagctgattgtgcgtgaggatgcacatctgctg
tatggctttggcagcactgatgagcgtatcgcatttcgccagttgcttaaaatcagcggt
gtcggtcccaagctcgccttgtcggtgctgtcggggctgagtttgaacgatctggccgac
gcggtcgcgaacaaggaggcgggccgtttaaccaaaattcccggcgtaggcaagaagacc
gccgagcgactgctgttggaattagagggtaaatttaccgtcatgggtgtggcgatggcg
catggtgtgccggtcacatcggctagcggcgatattgttaatgccttgcaggcgttgggc
tacaacgataaggaagccgctctggcagcaaagcagttacccaaagatgtgagcgtctct
gacgggatccgtcaggccctcaaatttttgtcacgggcgtaa

DBGET integrated database retrieval system