KEGG   Geobacillus sp. C56-T3: GC56T3_0030Help
Entry
GC56T3_0030       CDS       T01245                                 

Definition
(GenBank) methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
gct  Geobacillus sp. C56-T3
Pathway
gct00450  Selenocompound metabolism
gct00970  Aminoacyl-tRNA biosynthesis
gct01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gct00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    GC56T3_0030
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    GC56T3_0030
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:gct01007]
    GC56T3_0030
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:gct03016]
    GC56T3_0030
Enzymes [BR:gct01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     GC56T3_0030
Amino acid related enzymes [BR:gct01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   GC56T3_0030
Transfer RNA biogenesis [BR:gct03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    GC56T3_0030
 Prokaryotic type
   Other AARSs
    GC56T3_0030
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA_bind tRNA-synt_1e Anticodon_1 tRNA-synt_1f tRNA-synt_1d DNA_ligase_ZBD Zn-ribbon_8
Motif
Other DBs
NCBI-ProteinID: ADI25104
Position
43452..45404
Genome map
AA seq 650 aa AA seqDB search
MEKKTFYLTTPIYYPSDRLHIGHAYTTVAGDAMARYKRMRGYDVMYLTGTDEHGQKIQRK
AEEKGVTPQQYVDEIVAGIQELWKKLDISYDDFIRTTQERHKKVVEQIFTRLVEQGDIYL
GEYEGWYCTPCESFYTERQLVDGNCPDCGRPVEKVKEESYFFRMSKYVDRLLQYYEENPD
FIQPESRKNEMINNFIKPGLEDLAVSRTTFDWGIKVPGNPKHVIYVWIDALANYITALGY
GTDNDEKFRKYWPADVHLVGKEIVRFHTIYWPIMLMALGLPLPKKVFGHGWLLMKDGKMS
KSKGNVVDPVTLIDRYGLDALRYYLLREVPFGADGVFTPEGFIERINYDLANDLGNLLHR
TVAMIEKYFDGVIPPYRGPKTPFDQELAQTAREVVRQYEEAMEGMEFSVALAAVWQLISR
TNKYIDETQPWVLAKDEQKRDELAAVMTHLAESLRHMAVLLQPFLTRTPERMFAQLGITD
HSLKEWDSLYDFGLIPEGTKVQKGEPLFPRLDIEAEVEYIKAHMQGGKPAAEPVKEEKKA
AEAAEISIDEFAKVDLRVAEVIHAERMKNADKLLKLQLDLGGEKRQVISGIAEFYKPEEL
VGKKVICVANLKPAKLRGEWSEGMILAGGSGGEFSLATVDQHVPNGTKIK
NT seq 1953 nt NT seq  +upstreamnt  +downstreamnt
atggagaaaaaaacgttttatttgacgacgccgatttattacccgagcgaccgcctgcat
atcggtcatgcttacacaacggtggcgggggacgccatggctcgctataaacggatgcgc
ggctacgatgtcatgtatttgaccggcaccgatgagcatgggcaaaaaattcagcgcaag
gcggaagaaaaaggagtaacgccgcagcaatacgtcgatgagatcgtcgctggcattcag
gagctatggaagaagctcgacatttcctacgacgattttattcgcacaacgcaggagcgg
cataaaaaagtcgtcgaacaaattttcacccgtcttgtcgaacaaggcgatatttatttg
ggcgaatatgaaggctggtattgtacgccgtgcgaatcgttttacactgagcggcagctt
gtggacggcaactgtccggactgcggccggcctgttgagaaagtgaaagaagagtcctat
ttcttccggatgagcaaatatgtcgaccgcttgttgcaatattacgaagaaaatcccgat
tttatccaaccggaatcgcggaaaaatgagatgatcaacaacttcattaagccggggctt
gaggatttggctgtgtcccggacgacgttcgattggggcattaaagtgccaggcaatccg
aagcatgtcatctatgtctggatcgacgcgcttgccaactatatcacagcgctcggctac
ggcacggacaacgatgaaaagttccgcaaatattggccggcggacgtccatttggtcggc
aaagaaatcgtccgtttccatacgatttattggccgattatgttgatggcgctcggcttg
ccgttgccgaaaaaagtattcggccatggctggttgctgatgaaggatggaaaaatgtcc
aaatcgaaaggcaatgtcgtcgacccagtgacgctcatcgaccggtatgggcttgatgcg
ctccgctattatttgctgcgggaagtgccgttcggcgctgatggcgtgtttacgccggaa
ggatttattgagcgcatcaactatgacttggccaacgacttaggcaacttgttgcaccgt
actgtggcgatgatcgagaaatatttcgacggcgttattccgccataccgcgggccgaaa
acaccgtttgaccaagagttggcgcaaacggcgcgcgaagtggtgcgtcaatatgaagaa
gcgatggagggaatggagttttccgtcgcgcttgccgctgtttggcagttgattagccgg
acgaacaaatacatcgatgaaacgcagccatgggtattggcgaaagacgaacagaaacgg
gatgagcttgccgccgtcatgacccacttggctgaatcgctccgccatatggcggtgctg
ctccagccgtttttgacgcgcacgccggagcgcatgttcgctcagctcggcatcactgat
cattcattaaaagaatgggacagcttgtacgatttcggcctcattccggaagggacaaaa
gtgcaaaagggagaaccgctcttcccgcgcctcgacatcgaagcggaagtggagtacatt
aaggcgcatatgcaagggggcaaaccggccgccgaaccggtaaaagaggaaaaaaaagca
gcggaggcggcggaaatttcgattgacgagttcgccaaagtcgatttgcgcgtcgctgaa
gtcatccatgccgaacggatgaaaaacgccgataagctgttgaagcttcagcttgacctt
ggcggcgagaagcggcaagtgatctccggcattgctgagttttacaaaccagaagaactc
gtcggcaaaaaagtcatttgcgtcgccaatttaaaaccagccaagcttcgcggcgaatgg
tcggaaggcatgattctagccggaggcagcggcggggaattttcgctggcgacggttgat
caacacgtgccgaatggaacgaaaatcaaataa

DBGET integrated database retrieval system