KEGG   Geobacillus sp. C56-T3: GC56T3_0038Help
Entry
GC56T3_0038       CDS       T01245                                 

Definition
(GenBank) 4-diphosphocytidyl-2C-methyl-D-erythritol kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
gct  Geobacillus sp. C56-T3
Pathway
gct00900  Terpenoid backbone biosynthesis
gct01100  Metabolic pathways
gct01110  Biosynthesis of secondary metabolites
gct01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:gct00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    GC56T3_0038
Enzymes [BR:gct01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     GC56T3_0038
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_N GHMP_kinases_C
Motif
Other DBs
NCBI-ProteinID: ADI25112
Position
53281..54153
Genome map
AA seq 290 aa AA seqDB search
MRLSIKAPAKINLSLDVLYKRPDGYHEVKMVMTTIDLADRIELVALPEEDAIRIVSQNRF
VPDDCRNLAYQAAKLLKETFSIRQGVAISITKHIPVAAGLAGGSSDAAATLRGLNKLWQL
GLTMDELAELGAKIGSDVAFCVYGGTALATGRGEIITPIASPPPCWVVLAKPPIGVSTAE
VYRNLELERVSHPDVDAMVRAIERQDYAAICRLVGNVLEEVTLKKYPEVAHIKEQMKRFG
ADAVLMSGSGPTVFGLIEHDSRMQRVYNGLRGFCDQVFAVRMLGERHSLD
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
gtgaggttgtcgataaaagcgccggcgaaaatcaatttgtcactcgacgttctttataag
cgcccggatggttaccatgaagtgaaaatggtgatgacgacgatcgatttggccgatcgc
attgagcttgtcgcgttgccggaggaagatgcgatccgcatcgtttcgcaaaaccgcttt
gtgcccgatgattgccgcaacttggcgtatcaggcggcgaagcttcttaaagagacgttt
tcgatccgccaaggggtggccatttcgattacgaagcatattccggtggccgctggattg
gcgggaggaagtagcgatgcggcggcgacgctgcgcgggttgaacaagctttggcagctc
ggattaacgatggatgaactggcagagctcggggcgaaaatcggctcggatgtcgctttt
tgcgtctacggcggaaccgccttggcgacggggcgcggggaaatcatcactccgatcgct
tcaccgccgccgtgctgggttgtgctggccaagcccccgatcggtgtatcgacggcggaa
gtgtaccgaaacttggaacttgagcgtgtcagccatccggatgtcgatgcgatggtgaga
gcgatcgagcggcaagattatgcggcgatctgccggttggtcggcaacgttcttgaggaa
gtgacgttgaaaaaatatccggaagtcgcgcatattaaagaacaaatgaagcggtttggc
gctgatgcggtgctgatgagcggcagcgggccgaccgtgtttggactgatcgagcacgat
tccagaatgcagcgggtatacaatgggttgcgcggcttttgtgaccaagtgtttgcggtg
agaatgttaggagaacgacattctcttgattaa

DBGET integrated database retrieval system