KEGG   Geobacillus sp. C56-T3: GC56T3_0085Help
Entry
GC56T3_0085       CDS       T01245                                 

Definition
(GenBank) cysteinyl-tRNA synthetase
  KO
K01883  cysteinyl-tRNA synthetase [EC:6.1.1.16]
Organism
gct  Geobacillus sp. C56-T3
Pathway
gct00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:gct00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    GC56T3_0085
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:gct01007]
    GC56T3_0085
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:gct03016]
    GC56T3_0085
Enzymes [BR:gct01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.16  cysteine---tRNA ligase
     GC56T3_0085
Amino acid related enzymes [BR:gct01007]
 Aminoacyl-tRNA synthetase
  Class I (G)
   GC56T3_0085
Transfer RNA biogenesis [BR:gct03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    GC56T3_0085
 Prokaryotic Type
    GC56T3_0085
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1e DALR_2 tRNA-synt_1g tRNA-synt_1 tRNA-synt_1f tRNA-synt_1d tRNA-synt_1c DUF1447
Motif
Other DBs
NCBI-ProteinID: ADI25159
Position
108685..110085
Genome map
AA seq 466 aa AA seqDB search
MSSIRLYNTLTRKKEPFEPLEPNKVKMYVCGPTVYNYIHIGNARAAVVFDTIRRYLEFRG
YDVTYVSNFTDVDDKLIKAARELGESVPAIAERFIEAYFEDIQALGCKKADIHPRVTENI
DAIIEFIQALIDKGYAYEVDGDVYYRTRKFREYGKLSHQSIDELQAGARIEIGEKKDDPL
DFALWKAAKEGEICWDSPWGKGRPGWHIECSAMARKYLGDTIDIHAGGQDLTFPHHENEI
AQSEALTGKPFAKYWLHNGYLNINNEKMSKSLGNFVLVHDIIREIDPQVLRFFMLSVHYR
HPINYSEELLESARRGLERLKTAYSNLQHRLQASTNLTDNDEEWVSRIADIRASFIREMD
DDFNTANGIAVLFELAKQANLYLQEKTTSEKVIHAFLREFEQLADVLGLTLKQDELLDEE
IEALIQKRNEARKNRDFALADRIRDELRAKNIILEDTPQGTRWKRG
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atgagcagcatccggctttataatacgctgacgcgaaaaaaagaaccgtttgagccgttg
gagccgaataaagtgaaaatgtatgtgtgcggcccgaccgtctataattatattcacatc
ggcaatgctcgggccgccgtcgtttttgacacgatccgccgctatttggagttccgcggc
tatgatgtgacgtatgtatcgaactttaccgatgttgatgacaagttgatcaaagcggcc
cgcgagctcggcgagagcgtgccggcgattgctgagcggtttattgaggcgtattttgaa
gacattcaggcgcttggctgcaaaaaagcggacatccatccgcgggtgaccgaaaacatt
gatgcgattatcgaattcattcaggcgctcattgacaaaggatatgcctacgaagtcgac
ggcgacgtgtattaccggacgcgcaagttccgcgaatacggcaagctgtctcatcaatcg
atcgatgagctgcaagctggggcgcgcatcgaaattggggagaaaaaagacgatccactt
gatttcgccctttggaaagcagcgaaggaaggagaaatttgttgggacagtccatggggg
aaagggcggcctggttggcatatcgaatgctcggcgatggcgcgcaaatatttgggcgat
acgatcgatatccacgccggcggccaggacttgacattcccgcaccatgaaaacgaaatc
gcccagtcggaggcgctgaccggcaaaccgttcgcgaaatattggctgcacaatgggtat
ttaaatattaacaacgaaaaaatgtccaagtcgcttggcaatttcgtgctcgttcacgat
atcatccgggagatcgacccgcaagtgctgcgttttttcatgctatcggtgcattaccgc
catccgatcaactacagcgaggaactgcttgagagtgcgcggcgcggactcgagcgcctg
aagacggcgtacagcaatttgcagcatcgcctgcaggcaagcacgaacttaacggacaat
gacgaggaatgggtttcgcgcattgccgacatccgcgcctcgttcatccgtgaaatggac
gacgatttcaacacggcgaacggcattgccgtattgtttgaactggcgaagcaggccaac
ttgtacttgcaggaaaaaacgacatccgagaaggtcattcacgcgtttttgcgcgagttc
gaacagctggcggacgtacttggactcaccttgaagcaggatgagctgcttgatgaggaa
atcgaggcgttgatccaaaagcgcaatgaagcgcggaaaaaccgcgattttgcgctggcc
gaccgcattcgcgacgagttgagagcgaaaaacattattttggaagacacgccgcaagga
acgagatggaaacggggatag

DBGET integrated database retrieval system