KEGG   Geobacillus sp. C56-T3: GC56T3_0542Help
Entry
GC56T3_0542       CDS       T01245                                 

Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
gct  Geobacillus sp. C56-T3
Pathway
gct00260  Glycine, serine and threonine metabolism
gct00750  Vitamin B6 metabolism
gct01100  Metabolic pathways
gct01110  Biosynthesis of secondary metabolites
gct01120  Microbial metabolism in diverse environments
gct01230  Biosynthesis of amino acids
Module
gct_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:gct00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    GC56T3_0542
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    GC56T3_0542
Enzymes [BR:gct01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     GC56T3_0542
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP TPR_14
Motif
Other DBs
NCBI-ProteinID: ADI25595
Position
575399..576460
Genome map
AA seq 353 aa AA seqDB search
MAWKGLLDAYGEFLPLSAATPRLSLCEGNTPLIPLPRLSEELGIALYVKVEGANPTGSFK
DRGMVMAVAKAKEEGSHTIICASTGNTSASAAAYAARAGMRCLVVVPNGKIALGKLAQAA
MYGAEIFAIDGNFDEALKMVRRLSETAPITLVNSVNPYRIEGQKTAAFEVCDQLGRAPDV
LAIPVGNAGNITAYWKGFKEYHEAKGTGLPQMRGFEAEGAAAIVRNRVIEQPETVATAIR
IGNPASWDKAVEAASESRGKIDEVSDAEILAAYKRLARTEGIFAEPASCAAIAGVIKQRE
RNEIERGSLVVAVLTGNGLKDPAIALETAAIEPIVLPNDEQVVLEHLQGVVRT
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atggcatggaaagggctgcttgacgcctacggcgagtttttgccgctctctgcagcgacg
ccgaggctgtcgctttgcgaagggaatacgccgctcatcccgctgccgcgcttgtcggag
gagctcggcattgcgctctatgtcaaggtcgaaggggcgaacccgaccggttcgtttaaa
gaccgcggcatggtgatggcggtggccaaggcgaaagaggaaggaagccatacgatcatc
tgcgcctcaaccggcaatacatcggcttcagcggccgcctatgcggcgcgcgccggcatg
cgctgcctcgtcgtcgttccgaacggcaagatcgctctcggcaagttggcgcaagccgcc
atgtacggcgcggaaatttttgcgattgacggcaactttgacgaggcgctgaagatggtg
cgccggttgagcgaaacggcgccgattacgctcgtcaactcggtcaatccgtaccggatc
gaagggcaaaaaacggcggcgtttgaagtgtgcgaccagcttgggcgcgccccggacgtg
ctcgccattccagtcggcaacgccggcaacatcaccgcctattggaaagggtttaaggag
taccatgaagcgaaaggaacgggcttgccgcaaatgcgcggctttgaagcggaaggagcg
gcggcgatcgtccgcaaccgggtgattgaacagccggagacggtggcgaccgcgatccgc
atcggcaatccggcgagctgggacaaagcggtcgaggcggcgagcgagtcgcgcgggaaa
attgatgaggtgagcgacgcagaaattttggccgcctacaagcggctcgcccggacggaa
ggcatttttgccgaaccggcgtcatgcgcggcgatcgccggggtgatcaagcagcgcgaa
cggaacgaaatcgaacgcggcagcctcgtcgtggcggttctcactggcaacggattgaaa
gacccggccatcgccttggagaccgcggcgatcgaaccgatcgtgctgccgaacgatgaa
caagttgtcttggagcatttgcaaggggttgtccggacatga

DBGET integrated database retrieval system