KEGG   Geobacillus sp. C56-T3: GC56T3_1045Help
Entry
GC56T3_1045       CDS       T01245                                 

Definition
(GenBank) glucokinase, ROK family
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
gct  Geobacillus sp. C56-T3
Pathway
gct00010  Glycolysis / Gluconeogenesis
gct00052  Galactose metabolism
gct00500  Starch and sucrose metabolism
gct00520  Amino sugar and nucleotide sugar metabolism
gct00521  Streptomycin biosynthesis
gct01100  Metabolic pathways
gct01110  Biosynthesis of secondary metabolites
gct01120  Microbial metabolism in diverse environments
gct01130  Biosynthesis of antibiotics
gct01200  Carbon metabolism
Module
gct_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
gct_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:gct00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GC56T3_1045
   00052 Galactose metabolism
    GC56T3_1045
   00500 Starch and sucrose metabolism
    GC56T3_1045
   00520 Amino sugar and nucleotide sugar metabolism
    GC56T3_1045
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    GC56T3_1045
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    GC56T3_1045
Enzymes [BR:gct01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     GC56T3_1045
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK BcrAD_BadFG FtsA Hydant_A_N FGGY_N
Motif
Other DBs
NCBI-ProteinID: ADI26087
Position
1100484..1101437
Genome map
AA seq 317 aa AA seqDB search
MEPWLVGIDLGGTTIKMAFVTTEGDIVHKWEIPTNTANRGEHIVADIARSLEKTLAQLGG
AKERLLAAGIGAPGPVEEETGMLYETVNIGWTNYPLKQRLEEATGLPVSVDNDANLAALG
EMWKGAGGGARHLLFVTLGTGVGGGVIANGAIVRGINGAGGEIGHMTMIPDGGSRCNCGK
TGCLETIASATGIVRIAKEKLTADERPSELRNGDVTAKAVFDAAKAGDALALEVVDEATY
YLGWALANAANVTNPEKIVIGGGVSKAGDMLVERVAAHFRRFAFPRVAAGAKLVLATLGN
DAGVIGAAWLAKELVGA
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atggaaccatggttggtaggcattgacctcgggggcacgacaatcaaaatggcgtttgtc
accaccgagggtgacatcgtgcacaaatgggaaattccgacgaacaccgccaatcgcggt
gagcatatcgtcgctgacattgcccgatcgcttgaaaagacgctcgcccagctcggcgga
gcgaaagagaggctgcttgccgccggcatcggcgcccccggaccggtcgaagaggaaacc
ggcatgttgtatgagacggtcaatatagggtggacgaattatccattgaagcaacggctg
gaagaggcgacggggctgcccgtttcggtcgataatgacgccaatctcgccgcgcttggc
gaaatgtggaaaggagcagggggaggagcgcgccatttgttgtttgtgacgcttggcacc
ggcgttggcggcggtgtgattgccaacggagccattgtgcgcggcataaacggcgccggc
ggagagatcggacatatgacgatgatccctgatggcggctcccgttgcaactgcggcaaa
accggatgtttggaaacgattgcgtccgccaccggcatcgtgcggatcgccaaggagaaa
ttgaccgcagatgagcgtccgagtgagcttcgcaacggggatgtgacggccaaagcggtg
tttgacgccgccaaagcgggcgatgcgctggcattggaagtggtcgatgaagcaacgtac
tatcttggttgggcgttggcgaatgccgccaatgtgacgaacccggagaaaatcgtgatc
ggcggcggcgtgtccaaggcgggtgacatgcttgtcgagcgcgtggccgcccatttccgc
cgcttcgcgttcccgcgcgtcgccgctggggcgaagcttgttttagcgacgcttggcaac
gatgccggcgtcatcggcgccgcctggctggcgaaagagcttgtcggcgcgtaa

DBGET integrated database retrieval system