KEGG   Geobacillus sp. C56-T3: GC56T3_1293Help
Entry
GC56T3_1293       CDS       T01245                                 

Definition
(GenBank) Nucleoside-diphosphate kinase
  KO
K00940  nucleoside-diphosphate kinase [EC:2.7.4.6]
Organism
gct  Geobacillus sp. C56-T3
Pathway
gct00230  Purine metabolism
gct00240  Pyrimidine metabolism
gct01100  Metabolic pathways
gct01110  Biosynthesis of secondary metabolites
gct01130  Biosynthesis of antibiotics
Module
gct_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
gct_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
gct_M00052  Pyrimidine ribonucleotide biosynthesis, UMP => UDP/UTP,CDP/CTP
Brite
KEGG Orthology (KO) [BR:gct00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    GC56T3_1293
   00240 Pyrimidine metabolism
    GC56T3_1293
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:gct04131]
    GC56T3_1293
Enzymes [BR:gct01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.6  nucleoside-diphosphate kinase
     GC56T3_1293
Membrane trafficking [BR:gct04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    GC56T3_1293
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NDK
Motif
Other DBs
NCBI-ProteinID: ADI26319
Position
1344420..1344869
Genome map
AA seq 149 aa AA seqDB search
MAERTFIMVKPDGVQRNLIGEIVARFEKKGFQLVSAKLMQVSRELAEQHYAEHKERPFFG
ELVDFITSGPVFAMVWEGENVIAAARQMMGKTNPQEAAPGTIRGDFGLTVGKNVIHGSDS
PQSAEREISLFFKEEELVSYSKQINAWLY
NT seq 450 nt NT seq  +upstreamnt  +downstreamnt
atggcagaacggacattcatcatggtaaaaccggacggggttcagcgcaatttgatcggc
gagattgtcgcccgttttgaaaaaaaaggcttccagcttgtcagcgcgaagctgatgcaa
gtgtcgcgcgaactcgccgagcaacattacgctgaacataaggagcgcccgtttttcggc
gagcttgtcgactttatcacctcggggccagtgtttgcaatggtgtgggagggcgagaac
gtgatcgccgccgcccggcaaatgatggggaaaacgaatccgcaggaggctgcccctggc
acgatccgcggcgatttcggcttgacggtcggcaaaaatgtcatccacggctccgattcg
ccgcaaagcgccgaacgcgaaatcagtttgttctttaaagaagaagagctcgtcagctat
tcgaaacagatcaatgcatggctgtactga

DBGET integrated database retrieval system