KEGG   Geobacillus sp. C56-T3: GC56T3_1530Help
Entry
GC56T3_1530       CDS       T01245                                 

Definition
(GenBank) 3-hydroxybutyrate dehydrogenase
  KO
K00019  3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
gct  Geobacillus sp. C56-T3
Pathway
gct00072  Synthesis and degradation of ketone bodies
gct00650  Butanoate metabolism
gct01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gct00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    GC56T3_1530
  Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    GC56T3_1530
Enzymes [BR:gct01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.30  3-hydroxybutyrate dehydrogenase
     GC56T3_1530
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR Epimerase Polysacc_synt_2 Methyltransf_31 Methyltransf_25 Methyltransf_23 TrkA_N B12-binding 2-Hacid_dh_C RmlD_sub_bind 3HCDH_N Methyltransf_11 GDP_Man_Dehyd 3Beta_HSD CoA_binding_2 ACT CPT DFP Methyltransf_12 NAD_binding_7
Motif
Other DBs
NCBI-ProteinID: ADI26537
Position
1609964..1610737
Genome map
AA seq 257 aa AA seqDB search
MEHRTALITGAARGIGYEVAKTLAEHGANVVLIDLRQEEVEQAARSLRELGYEAVGVKCD
VTVEQEVKQAINEAVSRWGRLDVVVNNAGLQHVANIEDFPTEKFEQLIRVMLVGPFLAIK
HAFPIMKQQRYGRIINMASINGLVGFAGKAAYNSAKHGVIGLTKVAALEGAPHGITVNAL
CPGYVDTELVRGQLADLAATRNVPLEKVLEEVIYPFVPQRRLLSVEEVAHYVLFLAGEQA
KGITGQAVVIDGGYTAQ
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atggaacatcgcacagcactcatcaccggcgcagcgcggggaatcggctatgaagtggcg
aaaacgctggcggaacatggcgcaaacgtggtgctcattgatttgcgccaggaagaggtc
gagcaggctgctcgatcgcttcgggagttgggctatgaagcggtcggcgtgaaatgtgat
gtgacggttgaacaagaggtgaagcaagcgatcaacgaagcggtcagccgttgggggcgc
ctggatgttgtcgtgaacaacgctggtttgcaacatgtggcgaacatcgaggatttcccg
acggaaaaatttgaacagctcattcgcgtcatgcttgtcggcccatttttggccatcaag
catgcgtttcccattatgaaacaacagcgctacggccgcatcatcaatatggcgtcgatc
aacgggctcgtcgggtttgccggcaaagcggcgtacaacagcgcgaagcacggggtgatt
ggcttaacgaaagtggcagcgttagaaggggcgccacacggcattacggtgaacgccctt
tgcccgggttatgtcgataccgagctcgtgcgcggccagctcgcggatttggcggcgaca
agaaacgtgccgcttgagaaagtgctggaggaagtgatttacccgttcgtgccgcagcgg
cggctgctatcggttgaagaggtggctcattacgttctctttttggcgggggaacaagcc
aaaggcatcactggccaggcggtcgtgatcgatggcgggtatacggcgcaatga

DBGET integrated database retrieval system