KEGG   Geobacillus sp. C56-T3: GC56T3_1639Help
Entry
GC56T3_1639       CDS       T01245                                 

Definition
(GenBank) Aldose 1-epimerase
  KO
K01785  aldose 1-epimerase [EC:5.1.3.3]
Organism
gct  Geobacillus sp. C56-T3
Pathway
gct00010  Glycolysis / Gluconeogenesis
gct00052  Galactose metabolism
gct01100  Metabolic pathways
gct01110  Biosynthesis of secondary metabolites
gct01120  Microbial metabolism in diverse environments
gct01130  Biosynthesis of antibiotics
Module
gct_M00632  Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Brite
KEGG Orthology (KO) [BR:gct00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GC56T3_1639
   00052 Galactose metabolism
    GC56T3_1639
Enzymes [BR:gct01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     GC56T3_1639
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-ProteinID: ADI26641
Position
1732630..1733676
Genome map
AA seq 348 aa AA seqDB search
MRIRKETWSRFNEKEVLLFTLTNEHGMELSTTNYGCIVTDLRVPDRNGNIENVVLGFGRF
EPYVENAPYFGAVIGRVAGRIRGASFELDGITYQLAKNENNNHLHGGPNGFHRVLWQAEP
VWRDGAVGVVFSYTSPDGEEGYPGTVHVQVEYWLNNDNEWIVTHRARSDKTTLVNLTNHT
YFNLSGNAKRDILDHTLTIQSSRVLELNEELIPTGRILDVAGTPFDLRQGKAIREAVESG
HPQIELVGGGYDHPFWLDRHHDREIVLSDPESGRVLTVETDEVGVVVYTSNQLPKGLDLG
GVPSRKYLGICLETQGLPDAVHHPQFPSIVLPAGQERASTTVYRFGII
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
ttgcggattaggaaagaaacatggtctcgtttcaacgaaaaagaagttcttttatttacg
ttgacaaatgaacacggcatggaactgtccacgacaaactacggctgcatcgtgacggac
ctccgcgttcccgaccggaacggcaacatcgaaaatgtcgtgctcgggtttggacgattt
gaaccgtatgttgagaacgccccttatttcggcgccgtaatcggccgggtggcggggcgc
attcgcggggcgagcttcgaacttgatggaatcacatatcaactggcgaaaaacgaaaac
aacaaccacttgcacggcggtccgaacggattccaccgcgtgctttggcaggccgagccc
gtttggcgcgacggtgcggtgggggtcgtgttttcatacacaagcccggacggggaggaa
gggtacccgggaacggttcatgttcaagtggaatattggctgaacaatgacaacgaatgg
atcgtcacacaccgagctcgttcggacaaaacgacgctcgtcaatttgacgaaccatacg
tattttaacctaagcggcaacgccaagcgcgatattttggatcacacgttgacgatccaa
agctcgcgtgtgctcgagttgaatgaggagctgattccgacgggccgcatcttggatgtc
gccggcacgccgtttgacttgcggcaaggaaaggcgatccgggaggcggtcgaatccggg
catccgcaaattgaactcgttggcgggggttatgaccatccattttggctcgatcggcat
cacgacagggaaattgtgctttccgacccagagagtgggcgggtgctgacggtggagacg
gatgaggtcggcgtcgtcgtgtatacgtcaaaccaattgccgaaggggctggatttgggc
ggcgtgccgtcgcggaaatatttaggcatctgcctggaaacgcaaggactgccggatgcg
gttcatcatccgcagtttccgtcgatcgtattgccagctggccaagagcgagcatcaacg
acggtctatcggtttggcatcatttga

DBGET integrated database retrieval system