KEGG   Geobacillus sp. C56-T3: GC56T3_1745Help
Entry
GC56T3_1745       CDS       T01245                                 

Definition
(GenBank) cobyric acid synthase CobQ
  KO
K02232  adenosylcobyric acid synthase [EC:6.3.5.10]
Organism
gct  Geobacillus sp. C56-T3
Pathway
gct00860  Porphyrin and chlorophyll metabolism
gct01100  Metabolic pathways
Module
gct_M00122  Cobalamin biosynthesis, cobinamide => cobalamin
Brite
KEGG Orthology (KO) [BR:gct00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    GC56T3_1745
Enzymes [BR:gct01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.10  adenosylcobyric acid synthase (glutamine-hydrolysing)
     GC56T3_1745
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GATase_3 CbiA AAA_26 SNO UPF0181
Motif
Other DBs
NCBI-ProteinID: ADI26743
Position
1854404..1855915
Genome map
AA seq 503 aa AA seqDB search
MAKALPIMFQGTHSDAGKSVIATAFCRMFAQDGWKTAPFKSQNMSLNSYVTPDGNEIGRA
QGIQAEAAGVAARAEMNPILIKPSREHESQIVVLGKPYGNMQAFAYRNEFFHQGLAVIRQ
SLETLMNEYDRIVMEGAGSPAEVNLNDRELVNMRIARLANAPVVLIGDIERGGVFASLVG
TLSLLEPEDRKRVIGVIINKFRGDVALLKPGLDWFEQHTGVPVLGVVPYLPDLAIDAEDS
LSLERFASSVGGEEAIDVAVIRCPKIANFTDIDPLLAEPDCRVRLVTHADELGAPDVIVL
PGSKNTIEDLIYMKKRGLASRIVSLVNEGKARVVGLCGGYQMLGAVIRDPYGVETPLPEV
KGLGLLPIETTLERTKITIRTEGMLTWAGERFSVQGYEIHMGRSAPLPGYAPLIEADGRH
EGAKHSDERVLGTYMHDLFHNDAFRTAFFNSIRRQKGIAPSGVRPFRSLKEKAFDRLAAH
VRQHVAVERIEQMMRQFGCRDHS
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atggctaaggcgctgccgatcatgtttcaaggcactcattccgatgccggcaaaagtgtc
atcgccaccgcgttttgccgcatgttcgcccaggacggctggaagacggcgccgttcaag
tcgcaaaacatgtcgttaaactcctacgtgacgccggacggaaacgaaatcgggcgggcg
caaggaattcaggccgaagcggccggagtggcggcgcgcgccgagatgaatccgattttg
attaagccaagccgcgagcatgaatcgcaaatcgttgtgcttggcaaaccgtacggcaat
atgcaggcgttcgcttaccggaacgagtttttccaccaagggctggccgtcatccgtcag
tcgctcgaaacgttgatgaacgagtatgaccggattgtcatggaaggagcgggaagcccg
gcggaagtaaacttaaacgaccgcgagctcgtcaacatgcgcatcgcccgtctcgccaac
gccccggtcgtgttgatcggcgatattgagcggggcggggtgttcgcgagcctcgttgga
acgctgtcgttgcttgagcctgaggaccgaaagcgggtcattggggtcatcattaacaag
tttcgcggcgatgtggcgctgcttaagccggggcttgattggtttgagcagcacaccggc
gtgccggtgcttggcgtcgttccctatttgcctgatttggcgatcgatgctgaagattcg
ctgtcgcttgagcggtttgcttcatctgtcgggggagaggaagcgattgatgtcgctgtc
atccgctgtccgaaaatcgccaatttcaccgacatcgacccgcttttggccgaaccggac
tgccgcgtccggttggtcacgcacgccgatgagcttggcgcgccggatgtgatcgtgctt
cccggcagcaaaaacacgatcgaagacttgatttatatgaagaaaagaggactcgcttcc
cgcattgtgtcgcttgtcaatgaaggaaaagcgagagtcgtcggcttatgcggcggctac
caaatgcttggcgccgtcatccgcgatccgtatggagtcgagacgccgctcccggaagta
aaagggcttggtttgctgccgattgaaacgacgcttgagcggacgaaaatcacgatccgt
acggaagggatgcttacgtgggcgggcgagcggttttcggtgcaaggatacgagattcat
atgggccgctcggcgccgcttcctggctatgcgccgcttattgaggcggacggccgccat
gaaggggcgaagcacagtgatgagcgggtgctgggcacgtacatgcacgatttgtttcat
aacgatgcgttccgcaccgcgtttttcaacagcattcgccgccaaaaaggaatcgcccct
tctggcgtccgaccctttcgctcgctcaaagaaaaggcgttcgaccggcttgccgctcat
gtccgccagcacgtggcggtcgagcggatcgaacagatgatgcgtcaatttggctgtcgc
gatcacagttga

DBGET integrated database retrieval system