KEGG   Geobacillus sp. C56-T3: GC56T3_2069Help
Entry
GC56T3_2069       CDS       T01245                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
gct  Geobacillus sp. C56-T3
Pathway
gct00071  Fatty acid degradation
gct00072  Synthesis and degradation of ketone bodies
gct00280  Valine, leucine and isoleucine degradation
gct00310  Lysine degradation
gct00362  Benzoate degradation
gct00380  Tryptophan metabolism
gct00620  Pyruvate metabolism
gct00630  Glyoxylate and dicarboxylate metabolism
gct00640  Propanoate metabolism
gct00650  Butanoate metabolism
gct00900  Terpenoid backbone biosynthesis
gct01100  Metabolic pathways
gct01110  Biosynthesis of secondary metabolites
gct01120  Microbial metabolism in diverse environments
gct01130  Biosynthesis of antibiotics
gct01200  Carbon metabolism
gct01212  Fatty acid metabolism
gct02020  Two-component system
Brite
KEGG Orthology (KO) [BR:gct00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    GC56T3_2069
   00630 Glyoxylate and dicarboxylate metabolism
    GC56T3_2069
   00640 Propanoate metabolism
    GC56T3_2069
   00650 Butanoate metabolism
    GC56T3_2069
  09103 Lipid metabolism
   00071 Fatty acid degradation
    GC56T3_2069
   00072 Synthesis and degradation of ketone bodies
    GC56T3_2069
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    GC56T3_2069
   00310 Lysine degradation
    GC56T3_2069
   00380 Tryptophan metabolism
    GC56T3_2069
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    GC56T3_2069
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    GC56T3_2069
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    GC56T3_2069
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:gct04147]
    GC56T3_2069
Enzymes [BR:gct01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     GC56T3_2069
Exosome [BR:gct04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   GC56T3_2069
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt SpoVAD
Motif
Other DBs
NCBI-ProteinID: ADI27050
Position
complement(2172495..2173673)
Genome map
AA seq 392 aa AA seqDB search
MSTDIVLIEGARTPFAKFCGSFREISATDLGAIAAREAMKKAGIEPEEIDHVVFGNVQQS
SRDAHLLARHVGLKAGVPIDVPAVTVNRLCGTGLETIIMAARFILTGESEVVLAGGTENM
SQVPHVIRGMRWGAPLGSPTVEDWVWDGLYDTVGGCSMAITAENLAKKYDITREEADQHA
LRSHERALTAMANGYFRQEIVSVTVQGKKGEMIVDTDEHPRKTSLEQLRALQPRFLENGV
VTPGNASGMNDGAAAVIVASGDYAAKRGLKPLARLVSWGIVGVEPQYMGIGPVPAIRQAL
DKANLSIDDLDLIEINEAFSAQYLACQKELGFDDDKGNVNGGAVALGHPLAASGTRITLT
LVYELKRRGKKYGVSSLCIGGGQGIAAIWERL
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgtctacggatattgtgttgattgaaggagcacgaacgccatttgctaaattttgcggt
tcgtttcgtgaaatctccgcgaccgatttaggagctattgcggcgcgggaagcgatgaaa
aaagcaggaatcgagccagaagaaatcgaccatgttgtatttggcaatgtccagcagtca
agccgggatgctcacttgcttgctcgccacgtcggcttgaaggccggggtgcccatcgac
gtgccggctgtgacggtgaaccggttgtgcggaacgggactcgagacaattatcatggcg
gcgcgctttattttaaccggagaatcggaagtggtgttggcgggaggcactgaaaacatg
agccaagtgccgcacgtcatccgaggcatgcgctggggagcaccattaggcagcccaacg
gtggaggactgggtgtgggatggtctgtatgacacagttggcggctgtagcatggctata
acagcagaaaatttagcgaaaaaatatgacattacgcgcgaagaggctgaccaacatgcc
ctccgcagccatgaacgggcgcttacggcaatggccaatgggtatttccgccaagaaatt
gtctccgtcaccgtgcaaggaaaaaaaggagaaatgatcgttgacaccgatgagcatccg
cggaagaccagtttggagcagttaagggcgcttcaaccgcgctttctcgaaaacggagtc
gtgacaccaggcaatgccagtgggatgaacgacggtgcggccgcggttattgtcgcctcg
ggggactatgctgccaagcgcggattgaaaccgctcgcccgtctcgtttcgtggggcatc
gtcggagttgaaccgcagtatatggggattggccctgttccagcgattcgccaggcactc
gacaaagcgaatttatcaattgatgacctcgacttgattgaaatcaacgaagcattttca
gcccaatatttggcttgccagaaggaactgggatttgatgatgacaaaggcaacgtcaac
ggtggggcggtcgcgcttggccatccattggcagcttcaggaacgcgcatcacgttgaca
ctcgtttatgagttgaaaagaagaggaaagaaatacggtgtttcttcactatgcatcggc
ggcggccaaggcattgcggcgatctgggaaagactgtaa

DBGET integrated database retrieval system