KEGG   Geobacillus sp. C56-T3: GC56T3_3065Help
Entry
GC56T3_3065       CDS       T01245                                 

Definition
(GenBank) siroheme synthase
  KO
K02304  precorrin-2 dehydrogenase / sirohydrochlorin ferrochelatase [EC:1.3.1.76 4.99.1.4]
Organism
gct  Geobacillus sp. C56-T3
Pathway
gct00860  Porphyrin and chlorophyll metabolism
gct01100  Metabolic pathways
gct01110  Biosynthesis of secondary metabolites
gct01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:gct00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    GC56T3_3065
Enzymes [BR:gct01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.76  precorrin-2 dehydrogenase
     GC56T3_3065
 4. Lyases
  4.99  Other lyases
   4.99.1  Sole sub-subclass for lyases that do not belong in the other subclasses
    4.99.1.4  sirohydrochlorin ferrochelatase
     GC56T3_3065
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NAD_binding_7 Sirohm_synth_M TrkA_N CoA_binding_2 Shikimate_DH
Motif
Other DBs
NCBI-ProteinID: ADI27999
Position
complement(3208840..3209481)
Genome map
AA seq 213 aa AA seqDB search
MGYPVILQLRGRRAVVVGGGKVAARKIHGLLEAGAEIVMIAPEAEPELQALAAGGMIVWK
KKRFDPDDLAEAFLVIAATNDRKVNEAVTQAAAPGQLVNVVDDPERCDFHVPAVIRRGPL
TIAVSTGGASPAVARRIRRELEEKYGEEYRPYLEFLQRARGIVLREVEDAEGRKRLFQAL
AADSFRQRGRWDEELAQLLANEKERNGERGEEQ
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
atgggatatccagtgattcttcagcttcgcggccgtcgggcggtcgttgtcggcggcggg
aaggtggcggcaaggaaaattcatggattgttagaggcaggggcggaaatcgtgatgatt
gcgcctgaagcggagccggagcttcaagcgttggccgcgggggggatgatcgtttggaag
aaaaagcggtttgacccagacgatttggcggaggcctttttggtgattgccgcgacgaat
gatcgcaaggtgaatgaagcggtgacgcaagcagcagcacccggtcaactcgtaaatgtc
gtggatgatccggagcggtgtgattttcacgttcccgctgtcatccgccgcggtccgctc
acaattgccgtgtcgaccgggggggcaagtccggcggttgcccgccgcattcgccgcgag
cttgaggagaagtatggcgaagagtacaggccgtatcttgagtttttgcagcgggcccgc
ggcatcgtattgcgcgaagtggaggacgctgagggacggaagcggctgtttcaggcgctc
gctgctgattccttccggcagcgcggccgatgggatgaagagttggctcagctattggcg
aacgaaaaagaacgaaacggggaaagaggggaagagcaatga

DBGET integrated database retrieval system